ExPASy logo ExPASy Home page Site Map Search ExPASy Contact us Swiss-Prot
Notice: This page will be replaced with www.uniprot.org. Please send us your feedback!
Search for

UniProt
Swiss-ProtTrEMBL
UniProt Knowledgebase
Swiss-Prot Protein Knowledgebase
TrEMBL Protein Database

User Manual
Release 15.4 of 16-Jun-2009

Table of contents
Table of contents

1. What is the UniProt Knowledgebase?
1.1 The Swiss-Prot Protein Knowledgebase
1.2 The computer-annotated supplement TrEMBL
2. Conventions used in the database
2.1 General structure of the database
2.2 Status
2.3 Structure of a sequence entry
2.4 Non-experimental qualifiers
3. The different line types
3.1 The ID line
3.2 The AC line
3.3 The DT line
3.4 The DE line
3.5 The GN line
3.6 The OS line
3.7 The OG line
3.8 The OC line
3.9 The OX line
3.10 The OH line
3.11 The reference (RN, RP, RC, RX, RG, RA, RT, RL) lines
3.12 The CC line
3.13 The DR line
3.14 The PE line
3.15 The KW line
3.16 The FT line
3.17 The SQ line
3.18 The sequence data line
3.19 The // line
Appendix A : Amino-acid codes
Appendix B : Format differences between the Swiss-Prot and EMBL databases
B.1 Generalities
B.2 Differences in line types present in both databases
B.3 Line types defined by Swiss-Prot but currently not used by EMBL
B.4 Line types defined by EMBL but currently not used by Swiss-Prot
Appendix C : Documentation files
Appendix D : FTP access to Swiss-Prot and TrEMBL
D.1 Generalities
D.2 UniProt Knowledgebase
D.3 Biweekly updates of UniProtKB documents
D.4 Biweekly (cumulative) updates of Swiss-Prot
Appendix E : Relationships between Swiss-Prot and some biomolecular databases
1. What is the UniProt Knowledgebase?Table of contents

Until recently, the EBI/SIB Swiss-Prot + TrEMBL databases and the PIR Protein Sequence Database (PIR-PSD) coexisted as protein databases with differing protein sequence coverage and annotation priorities. In 2002, EBI, SIB, and PIR (at the Georgetown University Medical Center and National Biomedical Research Foundation) joined forces as the UniProt consortium. The primary mission of the consortium is to support biological research by maintaining a high quality database that serves as a stable, comprehensive, fully classified, richly and accurately annotated protein sequence knowledgebase, with extensive cross-references and querying interfaces freely accessible to the scientific community.

The UniProt Knowledgebase (UniProtKB) provides the central database of protein sequences with accurate, consistent, rich sequence and functional annotation.

The UniProt Knowledgebase consists of two sections: Swiss-Prot - a section containing manually-annotated records with information extracted from literature and curator-evaluated computational analysis, and TrEMBL - a section with computationally analyzed records that await full manual annotation.

1.1. The Swiss-Prot Protein KnowledgebaseTable of contents

Swiss-Prot is an annotated protein sequence database. It was established in 1986 and maintained collaboratively, since 1987, by the group of Amos Bairoch first at the Department of Medical Biochemistry of the University of Geneva and now at the Swiss Institute of Bioinformatics (SIB) and the EMBL Data Library (now the EMBL Outstation - The European Bioinformatics Institute (EBI)). The Swiss-Prot Protein Knowledgebase consists of sequence entries. Sequence entries are composed of different line types, each with their own format. For standardization purposes the format of Swiss-Prot follows as closely as possible that of the EMBL Nucleotide Sequence Database.

Swiss-Prot distinguishes itself from protein sequence databases by four distinct criteria:

a) Annotation

In Swiss-Prot, as in many sequence databases, two classes of data can be distinguished: the core data and the annotation.

For each sequence entry the core data consists of:

  • The sequence data;
  • The citation information (bibliographical references);
  • The taxonomic data (description of the biological source of the protein).

The annotation consists of the description of the following items:

  • Function(s) of the protein;
  • Posttranslational modification(s) such as carbohydrates, phosphorylation, acetylation and GPI-anchor;
  • Domains and sites, for example, calcium-binding regions, ATP-binding sites, zinc fingers, homeoboxes, SH2 and SH3 domains and kringle;
  • Secondary structure, e.g. alpha helix, beta sheet;
  • Quaternary structure, i.g. homodimer, heterotrimer, etc.;
  • Similarities to other proteins;
  • Disease(s) associated with any number of deficiencies in the protein;
  • Sequence conflicts, variants, etc.

We try to include as much annotation information as possible in Swiss-Prot. To obtain this information we use, in addition to the publications that report new sequence data, review articles to periodically update the annotations of families or groups of proteins. We also make use of external experts, who have been recruited to send us their comments and updates concerning specific groups of proteins.

We believe that having systematic recourse both to publications other than those reporting the core data and to subject referees represents a unique and beneficial feature of Swiss-Prot.

In Swiss-Prot, annotation is mainly found in the comment lines (CC), in the feature table (FT) and in the keyword lines (KW). Most comments are classified by 'topics'; this approach permits the easy retrieval of specific categories of data from the database.

b) Minimal redundancy

Many sequence databases contain, for a given protein sequence, separate entries which correspond to different literature reports. In Swiss-Prot we try as much as possible to merge all these data so as to minimize the redundancy of the database. If conflicts exist between various sequencing reports, they are indicated in the feature table of the corresponding entry.

c) Integration with other databases

It is important to provide the users of biomolecular databases with a degree of integration between the three types of sequence-related databases (nucleic acid sequences, protein sequences and protein tertiary structures) as well as with specialized data collections. Swiss-Prot is currently cross-referenced to more than 50 different databases. Cross-references are provided in the form of pointers to information related to Swiss-Prot entries and found in data collections other than Swiss-Prot. This extensive network of cross-references allows Swiss-Prot to play a major role as a focal point of biomolecular database interconnectivity.

d) Documentation

Swiss-Prot is distributed with a large number of index files and specialized documentation files. Some of these files have been available for a long time (this user manual, the release notes, the various indices for authors, citations, keywords, etc.), but many have been created recently and we are continuously adding new files. 'Documentation files' section contains an up-to-date descriptive list of all distributed document files.

1.2. The computer-annotated supplement TrEMBLTable of contents

TrEMBL is the computer-annotated section of the UniProt Knowledgebase. It contains translations of all coding regions in the DDBJ/EMBL/GenBank nucleotide databases, and protein sequences extracted from the literature or submitted to UniProtKB, which are not yet integrated into Swiss-Prot. TrEMBL allows these sequences to be made publicly available quickly without diluting the high quality annotation found in Swiss-Prot.

The information in a TrEMBL entry is initially derived directly from the underlying DDBJ/EMBL/GenBank nucleotide entry and the quality of data is directly dependent on the information provided by the submitter of the nucleotide entry. This information may be enhanced later by automatic annotation procedures (see below) but if not, it remains as provided by the submitter until the entry is manually annotated and added to Swiss-Prot.

After creation of a TrEMBL entry, a number of steps are taken to improve the data quality for users:

a) Automatic annotation

Records waiting in TrEMBL for full manual annotation are enhanced by automatic annotation. Information is transferred from well-characterised entries in Swiss-Prot to unannotated entries in TrEMBL which belong to groups defined by InterPro, a database of protein families, domains and functional sites. This process brings the standard of annotation in TrEMBL closer to that found in Swiss-Prot through the addition of accurate, high-quality information to TrEMBL entries, thus improving the quality of data available to the user.

b) Redundancy removal

Sequences from the same organism which are full-length and which have 100% identity are merged into a single entry to reduce redundancy.

c) Evidence attribution

TrEMBL contains data from a variety of sources including data which have been imported from the underlying nucleotide databases, data from specific programs, data from automatic annotation procedures, and some manual annotation. As it is essential for users to be able to identify the source of individual data items, a system of evidence attribution has been introduced. This system also allows UniProtKB staff to automatically update data if the underlying data source changes. This is ongoing internally and the evidence tags are currently visible in the XML version of TrEMBL as available by FTP.

2. Conventions used in the databaseTable of contents

The following sections describe the general conventions used in the knowledgebase to achieve uniformity of presentation. Experienced users of the EMBL Database can skip these sections and directly refer to this document, which lists the minor differences in format between the two data collections.

2.1. General structure of the database

The UniProt Knowledgebase is composed of sequence entries. Each entry corresponds to a single contiguous sequence as contributed to the bank or reported in the literature. In some cases, entries have been assembled from several papers that report overlapping sequence regions. Conversely, a single paper can provide data for several entries, e.g. when related sequences from different organisms are reported.

References to positions within a sequence are made using sequential numbering, beginning with 1 at the N-terminal end of the sequence.

The sequence data correspond to the precursor form of a protein before posttranslational modifications and processing.

2.2. Status

To distinguish the fully annotated entries in the Swiss-Prot section of the UniProt Knowledgebase from the computer-annotated entries in the TrEMBL section, the 'status' of each entry is indicated in the first (ID) line of each entry. The two defined classes are:

Reviewed Entries that have been manually reviewed and annotated by UniProtKB curators (Swiss-Prot section of the UniProt Knowledgebase).
Unreviewed Computer-annotated entries that have not been reviewed by UniProtKB curators (TrEMBL section of the UniProt Knowledgebase).
2.3. Structure of a sequence entry

The entries in the UniProt Knowledgebase are structured so as to be usable by human readers as well as by computer programs. The explanations, descriptions, classifications and other comments are in ordinary English. Wherever possible, symbols familiar to biochemists, protein chemists and molecular biologists are used.

Each sequence entry is composed of lines. Different types of lines, each with their own format, are used to record the various data that make up the entry. A sample sequence entry is shown below.

ID   GRAA_HUMAN              Reviewed;         262 AA.
AC   P12544; Q6IB36;
DT   01-OCT-1989, integrated into UniProtKB/Swiss-Prot.
DT   01-OCT-1989, sequence version 1.
DT   16-JUN-2009, entry version 113.
DE   RecName: Full=Granzyme A;
DE            EC=3.4.21.78;
DE   AltName: Full=Granzyme-1;
DE   AltName: Full=Cytotoxic T-lymphocyte proteinase 1;
DE   AltName: Full=Hanukkah factor;
DE            Short=H factor;
DE            Short=HF;
DE   AltName: Full=CTL tryptase;
DE   AltName: Full=Fragmentin-1;
DE   Flags: Precursor;
GN   Name=GZMA; Synonyms=CTLA3, HFSP;
OS   Homo sapiens (Human).
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
OC   Catarrhini; Hominidae; Homo.
OX   NCBI_TaxID=9606;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA].
RC   TISSUE=T-cell;
RX   MEDLINE=88125000; PubMed=3257574; DOI=10.1073/pnas.85.4.1184;
RA   Gershenfeld H.K., Hershberger R.J., Shows T.B., Weissman I.L.;
RT   "Cloning and chromosomal assignment of a human cDNA encoding a T cell-
RT   and natural killer cell-specific trypsin-like serine protease.";
RL   Proc. Natl. Acad. Sci. U.S.A. 85:1184-1188(1988).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
RA   Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.;
RT   "Cloning of human full open reading frames in Gateway(TM) system entry
RT   vector (pDONR201).";
RL   Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases.
RN   [3]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
RC   TISSUE=Blood;
RX   PubMed=15489334; DOI=10.1101/gr.2596504;
RG   The MGC Project Team;
RT   "The status, quality, and expansion of the NIH full-length cDNA
RT   project: the Mammalian Gene Collection (MGC).";
RL   Genome Res. 14:2121-2127(2004).
RN   [4]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-23.
RA   Goralski T.J., Krensky A.M.;
RT   "The upstream region of the human granzyme A locus contains both
RT   positive and negative transcriptional regulatory elements.";
RL   Submitted (NOV-1995) to the EMBL/GenBank/DDBJ databases.
RN   [5]
RP   PROTEIN SEQUENCE OF 29-53.
RX   MEDLINE=88330824; PubMed=3047119;
RA   Poe M., Bennett C.D., Biddison W.E., Blake J.T., Norton G.P.,
RA   Rodkey J.A., Sigal N.H., Turner R.V., Wu J.K., Zweerink H.J.;
RT   "Human cytotoxic lymphocyte tryptase. Its purification from granules
RT   and the characterization of inhibitor and substrate specificity.";
RL   J. Biol. Chem. 263:13215-13222(1988).
RN   [6]
RP   PROTEIN SEQUENCE OF 29-40, AND CHARACTERIZATION.
RX   MEDLINE=89009866; PubMed=3262682;
RA   Hameed A., Lowrey D.M., Lichtenheld M., Podack E.R.;
RT   "Characterization of three serine esterases isolated from human IL-2
RT   activated killer cells.";
RL   J. Immunol. 141:3142-3147(1988).
RN   [7]
RP   PROTEIN SEQUENCE OF 29-39, AND CHARACTERIZATION.
RX   MEDLINE=89035468; PubMed=3263427;
RA   Kraehenbuhl O., Rey C., Jenne D.E., Lanzavecchia A., Groscurth P.,
RA   Carrel S., Tschopp J.;
RT   "Characterization of granzymes A and B isolated from granules of
RT   cloned human cytotoxic T lymphocytes.";
RL   J. Immunol. 141:3471-3477(1988).
RN   [8]
RP   GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-170, AND MASS
RP   SPECTROMETRY.
RC   TISSUE=Liver;
RX   PubMed=19159218; DOI=10.1021/pr8008012;
RA   Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
RT   "Glycoproteomics analysis of human liver tissue by combination of
RT   multiple enzyme digestion and hydrazide chemistry.";
RL   J. Proteome Res. 8:651-661(2009).
RN   [9]
RP   3D-STRUCTURE MODELING OF 29-262.
RX   MEDLINE=89184501; PubMed=3237717; DOI=10.1002/prot.340040306;
RA   Murphy M.E.P., Moult J., Bleackley R.C., Gershenfeld H.,
RA   Weissman I.L., James M.N.G.;
RT   "Comparative molecular model building of two serine proteinases from
RT   cytotoxic T lymphocytes.";
RL   Proteins 4:190-204(1988).
RN   [10]
RP   X-RAY CRYSTALLOGRAPHY (2.4 ANGSTROMS) OF 29-262 IN COMPLEX WITH A
RP   TRIPEPTIDE CMK INHIBITOR.
RX   MEDLINE=22708839; PubMed=12819769; DOI=10.1038/nsb944;
RA   Bell J.K., Goetz D.H., Mahrus S., Harris J.L., Fletterick R.J.,
RA   Craik C.S.;
RT   "The oligomeric structure of human granzyme A is a determinant of its
RT   extended substrate specificity.";
RL   Nat. Struct. Biol. 10:527-534(2003).
RN   [11]
RP   X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 29-262 IN COMPLEX WITH
RP   SUBSTRATE.
RX   MEDLINE=22708840; PubMed=12819770; DOI=10.1038/nsb945;
RA   Hink-Schauer C., Estebanez-Perpina E., Kurschus F.C., Bode W.,
RA   Jenne D.E.;
RT   "Crystal structure of the apoptosis-inducing human granzyme A dimer.";
RL   Nat. Struct. Biol. 10:535-540(2003).
CC   -!- FUNCTION: This enzyme is necessary for target cell lysis in cell-
CC       mediated immune responses. It cleaves after Lys or Arg. May be
CC       involved in apoptosis.
CC   -!- CATALYTIC ACTIVITY: Hydrolysis of proteins, including fibronectin,
CC       type IV collagen and nucleolin. Preferential cleavage: -Arg-|-
CC       Xaa-, -Lys-|-Xaa- >> -Phe-|-Xaa- in small molecule substrates.
CC   -!- SUBUNIT: Homodimer; disulfide-linked.
CC   -!- INTERACTION:
CC       Self; NbExp=1; IntAct=EBI-519800, EBI-519800;
CC       O75489:NDUFS3; NbExp=1; IntAct=EBI-519800, EBI-1224896;
CC   -!- SUBCELLULAR LOCATION: Secreted. Cytoplasmic granule.
CC   -!- SIMILARITY: Belongs to the peptidase S1 family. Granzyme
CC       subfamily.
CC   -!- SIMILARITY: Contains 1 peptidase S1 domain.
CC   -----------------------------------------------------------------------
CC   Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
CC   Distributed under the Creative Commons Attribution-NoDerivs License
CC   -----------------------------------------------------------------------
DR   EMBL; M18737; AAA52647.1; -; mRNA.
DR   EMBL; CR456968; CAG33249.1; -; mRNA.
DR   EMBL; BC015739; AAH15739.1; -; mRNA.
DR   EMBL; U40006; AAD00009.1; -; Genomic_DNA.
DR   IPI; IPI00024657; -.
DR   PIR; A31372; A31372.
DR   RefSeq; NP_006135.1; -.
DR   UniGene; Hs.90708; -.
DR   PDB; 1HF1; Model; -; A=29-262.
DR   PDB; 1OP8; X-ray; 2.50 A; A/B/C/D/E/F=29-262.
DR   PDB; 1ORF; X-ray; 2.40 A; A=29-262.
DR   PDBsum; 1HF1; -.
DR   PDBsum; 1OP8; -.
DR   PDBsum; 1ORF; -.
DR   IntAct; P12544; 4.
DR   MEROPS; S01.135; -.
DR   PRIDE; P12544; -.
DR   Ensembl; ENSG00000145649; Homo sapiens.
DR   GeneID; 3001; -.
DR   KEGG; hsa:3001; -.
DR   GeneCards; GC05P054434; -.
DR   H-InvDB; HIX0004862; -.
DR   HGNC; HGNC:4708; GZMA.
DR   MIM; 140050; gene.
DR   PharmGKB; PA29086; -.
DR   HOGENOM; P12544; -.
DR   HOVERGEN; P12544; -.
DR   BRENDA; 3.4.21.78; 247.
DR   Pathway_Interaction_DB; il12_2pathway; IL12-mediated signaling events.
DR   NextBio; 11900; -.
DR   ArrayExpress; P12544; -.
DR   Bgee; P12544; -.
DR   CleanEx; HS_GZMA; -.
DR   GermOnline; ENSG00000145649; Homo sapiens.
DR   GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell.
DR   GO; GO:0001772; C:immunological synapse; TAS:UniProtKB.
DR   GO; GO:0005634; C:nucleus; TAS:UniProtKB.
DR   GO; GO:0042803; F:protein homodimerization activity; IDA:UniProtKB.
DR   GO; GO:0004252; F:serine-type endopeptidase activity; IDA:UniProtKB.
DR   GO; GO:0006922; P:cleavage of lamin; IDA:UniProtKB.
DR   GO; GO:0019835; P:cytolysis; IEA:UniProtKB-KW.
DR   GO; GO:0006955; P:immune response; TAS:UniProtKB.
DR   GO; GO:0006508; P:proteolysis; IEA:InterPro.
DR   InterPro; IPR018114; Peptidase_S1/S6_AS.
DR   InterPro; IPR001254; Peptidase_S1_S6.
DR   InterPro; IPR001314; Peptidase_S1A.
DR   Pfam; PF00089; Trypsin; 1.
DR   PRINTS; PR00722; CHYMOTRYPSIN.
DR   SMART; SM00020; Tryp_SPc; 1.
DR   PROSITE; PS50240; TRYPSIN_DOM; 1.
DR   PROSITE; PS00134; TRYPSIN_HIS; 1.
DR   PROSITE; PS00135; TRYPSIN_SER; 1.
PE   1: Evidence at protein level;
KW   3D-structure; Apoptosis; Cytolysis; Direct protein sequencing;
KW   Disulfide bond; Glycoprotein; Hydrolase; Polymorphism; Protease;
KW   Secreted; Serine protease; Signal; Zymogen.
FT   SIGNAL        1     26
FT   PROPEP       27     28       Activation peptide.
FT                                /FTId=PRO_0000027393.
FT   CHAIN        29    262       Granzyme A.
FT                                /FTId=PRO_0000027394.
FT   DOMAIN       29    259       Peptidase S1.
FT   ACT_SITE     69     69       Charge relay system.
FT   ACT_SITE    114    114       Charge relay system.
FT   ACT_SITE    212    212       Charge relay system.
FT   CARBOHYD    170    170       N-linked (GlcNAc...).
FT   DISULFID     54     70
FT   DISULFID    148    218
FT   DISULFID    179    197
FT   DISULFID    208    234
FT   VARIANT     121    121       T -> M (in dbSNP:rs3104233).
FT                                /FTId=VAR_024291.
FT   STRAND       43     47
FT   STRAND       49     51
FT   STRAND       53     60
FT   STRAND       63     66
FT   STRAND       77     81
FT   STRAND       83     87
FT   STRAND       93     95
FT   STRAND       97    102
FT   TURN        108    111
FT   STRAND      116    122
FT   STRAND      147    153
FT   STRAND      167    174
FT   HELIX       176    179
FT   TURN        182    187
FT   STRAND      195    199
FT   STRAND      215    218
FT   STRAND      221    228
FT   STRAND      241    245
FT   HELIX       248    259
SQ   SEQUENCE   262 AA;  28969 MW;  DA87363A0D92BAF4 CRC64;
     MRNSYRFLAS SLSVVVSLLL IPEDVCEKII GGNEVTPHSR PYMVLLSLDR KTICAGALIA
     KDWVLTAAHC NLNKRSQVIL GAHSITREEP TKQIMLVKKE FPYPCYDPAT REGDLKLLQL
     TEKAKINKYV TILHLPKKGD DVKPGTMCQV AGWGRTHNSA SWSDTLREVN ITIIDRKVCN
     DRNHYNFNPV IGMNMVCAGS LRGGRDSCNG DSGSPLLCEG VFRGVTSFGL ENKCGDPRGP
     GVYILLSKKH LNWIIMTIKG AV
//

Entries from the TrEMBL section follow the same format. For format differences see the description of the distinct line types.

Each line begins with a two-character line code, which indicates the type of data contained in the line. The current line types and line codes and the order in which they appear in an entry, are shown in the table below.

Line code Content Occurrence in an entry
IDIdentificationOnce; starts the entry
ACAccession number(s)Once or more
DTDateThree times
DEDescriptionOnce or more
GNGene name(s)Optional
OSOrganism speciesOnce or more
OGOrganelleOptional
OCOrganism classificationOnce or more
OXTaxonomy cross-referenceOnce
OHOrganism hostOptional
RNReference numberOnce or more
RPReference positionOnce or more
RCReference comment(s)Optional
RXReference cross-reference(s)Optional
RGReference groupOnce or more (Optional if RA line)
RAReference authorsOnce or more (Optional if RG line)
RTReference titleOptional
RLReference locationOnce or more
CCComments or notesOptional
DRDatabase cross-referencesOptional
PEProtein existenceOnce
KWKeywordsOptional
FTFeature table dataOnce or more
SQSequence headerOnce
(blanks)Sequence dataOnce or more
//Termination lineOnce; ends the entry

As shown in the above table, some line types are found in all entries, others are optional. Some line types occur many times in a single entry. Each entry must begin with an identification line (ID) and end with a terminator line (//).

A detailed description of each line type is given in the next section of this document. It must be noted that, with the exception of GN, all line types exist in the EMBL Database. A description of the format differences between the UniProt Knowledgebase and EMBL databases is given in this document.

The two-character line-type code that begins each line is always followed by three blanks, so that the actual information begins with the sixth character. In general, information is not extended beyond character position 75, there are however a few exceptions where lines may be longer (e.g. OH lines, CC lines that contain the 'WEB RESOURCE' topic (see section 3.22), etc.).

2.4. Non-experimental qualifiersTable of contents

3 types of non-experimental qualifiers in comment (CC) lines and feature table (FT lines) indicate that the information given is not based on experimentally proven findings:

  • Potential
  • Probable
  • By similarity

The term 'Potential' indicates that there is some logical or conclusive evidence that the given annotation could apply. This non-experimental qualifier is often used to present the results from protein sequence analysis tools, which are only annotated, if the result makes sense in the context of a given protein. A typical example is the annotation of N-glycosylation sites in the entries of non-cytoplasmic domains or proteins.

The term 'Probable' is stronger than the qualifier 'Potential' and there must be at least some experimental evidence, which indicates, that the given information is expected to be found in the natural environment of a protein.

'By similarity' is added to facts that were proven for a protein or part of it, and which is then transferred to other protein family members within a certain taxonomic range, dependent on the biological event or characteristic. Non-experimental qualifiers are also assigned to biologically important sites found within conserved domains e.g. active sites within an enzymatic domain or disulfide bonds that stabilize the structure of extracellular modules.

Examples of the usage of non-experimental qualifiers are described in the document annbioch.txt.

3. The different line typesTable of contents

3.1. The ID lineTable of contents

The ID (IDentification) line is always the first line of an entry. The general form of the ID line is:

ID   EntryName Status; SequenceLength.
3.1.1. Entry name

The first item on the ID line is the entry name of the sequence. This name is a useful means of identifying a sequence, but it is not a stable identifier as is the accession number (see 3.2). The ID tracker ascertains the relevant accession numbers for Swiss-Prot entry names that are no longer in use.

a) Swiss-Prot entry names

The Swiss-Prot entry name consists of up to 11 uppercase alphanumeric characters. Swiss-Prot uses a general purpose naming convention that can be symbolized as X_Y, where:

  • X is a mnemonic code of at most 5 alphanumeric characters representing the protein name. Examples: B2MG is for Beta-2-microglobulin, HBA is for Hemoglobin alpha chain and INS is for Insulin, CAD17 for Cadherin-17;
  • The '_' sign serves as a separator;
  • Y is a mnemonic species identification code of at most 5 alphanumeric characters representing the biological source of the protein. This code is generally made of the first three letters of the genus and the first two letters of the species.

Examples:

PSEPU is for Pseudomonas putida and NAJNI is for Naja nivea.

However, for species most commonly encountered in the database, self-explanatory codes are used. There are 16 of those codes: BOVIN for Bovine, CHICK for Chicken, ECOLI for Escherichia coli, HORSE for Horse, HUMAN for Human, MAIZE for Maize (Zea mays), MOUSE for Mouse, PEA for Garden pea (Pisum sativum), PIG for Pig, RABIT for Rabbit, RAT for Rat, SHEEP for Sheep, SOYBN for Soybean (Glycine max), TOBAC for Common tobacco (Nicotina tabacum), WHEAT for Wheat (Triticum aestivum), and YEAST for Baker's yeast (Saccharomyces cerevisiae).

As it was not possible to apply the above rules to viruses, they were given arbitrary, but generally easy-to-remember identification codes.

Examples of complete protein sequence entry names are: RL1_ECOLI for ribosomal protein L1 from Escherichia coli,, AFTIN_HUMAN for Aftiphilin from human, SODC_DROME for Superoxide dismutase [Cu-Zn] from Drosophila melanogaster.

The names of all the presently-defined species identification codes are listed in the document file speclist.txt.

b) TrEMBL entry names

The TrEMBL entry name consists of up to 12 uppercase alphanumeric characters. TrEMBL uses a general purpose naming convention similar to that of Swiss-Prot, where:

  • X is identical to the accession number of the entry
  • The '_' sign serves as a separator;
  • Y is a mnemonic species identification code.

As it is not possible in a reasonable timeframe to manually assign organism codes to all species represented in TrEMBL, "virtual" codes have been defined that regroup organisms at a certain taxonomic level. Such codes are prefixed by the number "9" and generally correspond to a "pool" of organisms, which can be 'wide' as a kingdom. Here are some examples of such codes:

9BACT B      2: N=Bacteria
9CNID E   6073: N=Cnidaria
9FUNG E   4751: N=Fungi
9REOV V  10880: N=Reoviridae
9TETR E  32523: N=Tetrapoda
9VIRI E  33090: N=Viridiplantae

These type of "virtual" codes are also listed in the document file speclist.txt.

Examples of complete TrEMBL entry names are O95417_HUMAN, Q9VVG0_DROME, P71025_BACSU or Q9SR52_ARATH.

3.1.2. Status

The second item on the ID line indicates the status of the entry (see section 2.2).

3.1.3. Length of the molecule

The third and last item of the ID line is the length of the molecule, which is the total number of amino acids in the sequence. This number includes the positions reported to be present but which have not been determined (coded as 'X'). The length is followed by the letter code 'AA' (Amino Acids).

3.1.4. Examples of identification lines

Two examples of Swiss-Prot ID lines are shown below:

ID   CYC_BOVIN               Reviewed;         104 AA.
ID   GIA2_GIALA              Reviewed;         296 AA.

Example of a TrEMBL ID line:

ID   Q5JU06_HUMAN            Unreviewed;       268 AA.
3.2. The AC lineTable of contents

The AC (ACcession number) line lists the accession number(s) associated with an entry. The format of the AC line is:

AC   AC_number_1;[ AC_number_2;]...[ AC_number_N;]

An example of an accession number line is shown below:

AC   P00321;

Semicolons separate the accession numbers and a semicolon terminates the list. If necessary, more than one AC line can be used. Example:

AC   Q16653; O00713; O00714; O00715; Q13054; Q13055; Q14855; Q92891;
AC   Q92892; Q92893; Q92894; Q92895; Q93053; Q96KU9; Q96KV0; Q96KV1;
AC   Q99605;

The purpose of accession numbers is to provide a stable way of identifying entries from release to release. It is sometimes necessary for reasons of consistency to change the names of the entries, for example, to ensure that related entries have similar names. However, an accession number is always conserved, and therefore allows unambiguous citation of entries.

Researchers who wish to cite entries in their publications should always cite the first accession number. This is commonly referred to as the 'primary accession number'. 'Secondary accession numbers' are sorted alphanumerically.

We strongly advise those users who have programs performing mappings of Swiss-Prot to another data resource to use Swiss-Prot accession numbers to identify an entry.

Entries will have more than one accession number if they have been merged or split. For example, when two entries are merged into one, the accession numbers from both entries are stored in the AC line(s).

If an existing entry is split into two or more entries (a rare occurrence), the original accession numbers are retained in all the derived entries and a new primary accession number is added to all the entries.

An accession number is dropped only when the data to which it was assigned have been completely removed from the database. Accession numbers deleted from Swiss-Prot are listed in the document file delac_sp.txt and those deleted from TrEMBL are listed in delac_tr.txt.

Accession numbers consist of 6 alphanumerical characters in the following format:

1 2 3 4 5 6
[A-N,R-Z] [0-9] [A-Z] [A-Z, 0-9] [A-Z, 0-9] [0-9]
[O,P,Q] [0-9] [A-Z, 0-9] [A-Z, 0-9] [A-Z, 0-9] [0-9]

Here are some examples of valid accession numbers: P12345, Q1AAA9, O456A1 and P4A123.

3.3. The DT lineTable of contents

The DT (DaTe) lines show the date of creation and last modification of the database entry.

The format of the DT line in Swiss-Prot is:

DT   DD-MMM-YYYY, integrated into UniProtKB/database_name.
DT   DD-MMM-YYYY, sequence version x.
DT   DD-MMM-YYYY, entry version x.

Where 'DD' is the day, 'MMM' the month and 'YYYY' the year, respectively. The dates shown in DT lines correspond to the date of the biweekly release at which an entry was integrated or updated. There are always three DT lines in each entry, each of them is associated with a specific comment:

  • The first DT line indicates when the entry first appeared in the database. The associated comment, 'integrated into UniProtKB/database_name', indicates in which section of UniProtKB, Swiss-Prot or TrEMBL, the entry can be found;
  • The second DT line indicates when the sequence data was last modified. The associated comment, 'sequence version', indicates the sequence version number. The sequence version number of an entry is incremented by one when the amino acid sequence shown in the sequence record is modified;
  • The third DT line indicates when data other than the sequence was last modified. The associated comment, 'entry version', indicates the entry version number. The entry version number is incremented by one whenever any data in the flat file representation of the entry is modified.

Example of a block of Swiss-Prot DT lines:

DT   01-OCT-1996, integrated into UniProtKB/Swiss-Prot.
DT   01-OCT-1996, sequence version 1.
DT   07-FEB-2006, entry version 49.

Example of a block of TrEMBL DT lines:

DT   01-FEB-1999, integrated into UniProtKB/TrEMBL.
DT   15-OCT-2000, sequence version 2.
DT   15-DEC-2004, entry version 5.

Whenever the sequence of an entry is updated there is always also an annotation update. The date in the third DT line is thus always at least as recent as the one in the second DT line.

Note that sequence and entry versions are not reset when an entry moves from Swiss-Prot to TrEMBL. The date of integration into Swiss-Prot can be more recent than the last sequence update.

DT   25-OCT-2005, integrated into UniProtKB/Swiss-Prot.
DT   01-NOV-1996, sequence version 1.
DT   07-FEB-2006, entry version 35.

A comprehensive archive of UniProtKB/Swiss-Prot and UniProtKB/TrEMBL entry versions is available: the UniProtKB Sequence/Annotation Version Database (UniSave) is a repository of UniProtKB/Swiss-Prot and UniProtKB/TrEMBL entry versions. Unlike the UniProt Knowledgebase, which contains only the latest Swiss-Prot and TrEMBL entry and sequence versions, the UniProtKB Sequence/Annotation Version Database provides access to all versions of these entries. This allows to track sequence changes, to find out when a given annotation appeared in an entry and how it evolved.

3.4. The DE lineTable of contents

The DE (DEscription) lines contain general descriptive information about the sequence stored. This information is generally sufficient to identify the protein precisely.

a) The DE line in Swiss-Prot

The description always starts with the recommended name (RecName) of the protein. Alternative names (AltName) are indicated thereafter.

The DE line contains 3 categories, as well as several subcategories, of protein names:

Category FieldSubcategory FieldCardinalityDescription
RecName:1 in UniProtKB/Swiss-Prot
0-1 in UniProtKB/TrEMBL
The name recommended by the UniProt consortium.
Full=1 The full name.
Short=0-n An abbreviation of the full name or an acronym.
EC=0-n An Enzyme Commission number.
AltName:0-n A synonym of the recommended name.
Full=0-1 The full name.
Short=0-n An abbreviation of the full name or an acronym.
EC=0-n An Enzyme Commission number.
AltName:Allergen=0-1 See allergen.txt.
AltName:Biotech=0-1 A name used in a biotechnological context.
AltName:CD_antigen=0-n See cdlist.txt.
AltName:INN=0-n The international nonproprietary name: A generic name for a pharmaceutical substance or active pharmaceutical ingredient that is globally recognized and is a public property.
SubName:0 in UniProtKB/Swiss-Prot
0-n in UniProtKB/TrEMBL
A name provided by the submitter of the underlying nucleotide sequence.
Full=1 The full name.
EC=0-n An Enzyme Commission number.

Each name is shown on a separate line; lines may therefore exceed 75 characters.

Protein naming guidelines are described in the document file nameprot.txt.

DE   RecName: Full=Annexin A5;
DE            Short=Annexin-5;
DE   AltName: Full=Annexin V;
DE   AltName: Full=Lipocortin V;
DE   AltName: Full=Endonexin II;
DE   AltName: Full=Calphobindin I;
DE   AltName: Full=CBP-I;
DE   AltName: Full=Placental anticoagulant protein I;
DE            Short=PAP-I;
DE   AltName: Full=PP4;
DE   AltName: Full=Thromboplastin inhibitor;
DE   AltName: Full=Vascular anticoagulant-alpha;
DE            Short=VAC-alpha;
DE   AltName: Full=Anchorin CII;
DE   RecName: Full=Granulocyte colony-stimulating factor;
DE            Short=G-CSF;
DE   AltName: Full=Pluripoietin;
DE   AltName: Full=Filgrastim;
DE   AltName: Full=Lenograstim;
DE   Flags: Precursor;

A block of DE lines may further contain multiple Includes: and/or Contains: sections and a separate field Flags: to indicate whether the protein sequence is a precursor or a fragment:

FieldCardinalityValue
Includes:0-n A block of protein names as described in the table above.
Contains:0-n A block of protein names as described in the table above.
Flags:0-1 Precursor and/or Fragment or Fragments

If a protein is known to be cleaved into multiple functional components, the description starts with the name of the precursor protein, followed by 'Contains:' section(s). Each individual component is described in a separate 'Contains:' section Alternative names (AltName) are allowed for each individual component. Example:

DE   RecName: Full=Corticotropin-lipotropin;
DE   AltName: Full=Pro-opiomelanocortin;
DE            Short=POMC;
DE   Contains:
DE     RecName: Full=NPP;
DE   Contains:
DE     RecName: Full=Melanotropin gamma;
DE     AltName: Full=Gamma-MSH;
DE   Contains:
DE     RecName: Full=Potential peptide;
DE   Contains:
DE     RecName: Full=Corticotropin;
DE     AltName: Full=Adrenocorticotropic hormone;
DE              Short=ACTH;
DE   Contains:
DE     RecName: Full=Melanotropin alpha;
DE     AltName: Full=Alpha-MSH;
DE   Contains:
DE     RecName: Full=Corticotropin-like intermediary peptide;
DE              Short=CLIP;
DE   Contains:
DE     RecName: Full=Lipotropin beta;
DE     AltName: Full=Beta-LPH;
DE   Contains:
DE     RecName: Full=Lipotropin gamma;
DE     AltName: Full=Gamma-LPH;
DE   Contains:
DE     RecName: Full=Melanotropin beta;
DE     AltName: Full=Beta-MSH;
DE   Contains:
DE     RecName: Full=Beta-endorphin;
DE   Contains:
DE     RecName: Full=Met-enkephalin;
DE   Flags: Precursor;

If a protein is known to include multiple functional domains each of which is described by a different name, the description starts with the name of the overall protein, followed by 'Includes:' section(s). All the domains are listed in a separate 'Includes:' section. Alternative names (AltName) are allowed for each individual domain. Example:

DE   RecName: Full=CAD protein;
DE   Includes:
DE     RecName: Full=Glutamine-dependent carbamoyl-phosphate synthase;
DE              EC=6.3.5.5;
DE   Includes:
DE     RecName: Full=Aspartate carbamoyltransferase;
DE              EC=2.1.3.2;
DE   Includes:
DE     RecName: Full=Dihydroorotase;
DE              EC=3.5.2.3;

In rare cases, the functional domains of an enzyme are cleaved, but the catalytic activity can only be observed, when the individual chains reorganize in a complex. Such proteins are described in the DE line by a combination of both 'Includes:' and 'Contains:', in the order given in the following example:

DE   RecName: Full=Arginine biosynthesis bifunctional protein argJ;
DE   Includes:
DE     RecName: Full=Glutamate N-acetyltransferase;
DE              EC=2.3.1.35;
DE     AltName: Full=Ornithine acetyltransferase;
DE              Short=OATase;
DE     AltName: Full=Ornithine transacetylase;
DE   Includes:
DE     RecName: Full=Amino-acid acetyltransferase;
DE              EC=2.3.1.1;
DE     AltName: Full=N-acetylglutamate synthase;
DE              Short=AGS;
DE   Contains:
DE     RecName: Full=Arginine biosynthesis bifunctional protein argJ alpha chain;
DE   Contains:
DE     RecName: Full=Arginine biosynthesis bifunctional protein argJ beta chain;

When the mature form of a protein is derived by processing of a precursor, we indicate this fact using the Flag 'Precursor'; in such cases the sequence displayed does not correspond to the mature form of the protein.

DE   RecName: Full=Chondroitin proteoglycan 3;
DE   Flags: Precursor;

If the complete sequence is not determined, we indicate it in the 'Flags' section with 'Fragment' or 'Fragments'. Example:

DE   RecName: Full=Dihydrodipicolinate reductase;
DE            Short=DHPR;
DE            EC=1.3.1.26;
DE   Flags: Fragment;
b) The DE line in TrEMBL

The format of the DE line in TrEMBL follows closely the format used in Swiss-Prot. However, as TrEMBL is not manually annotated, the description is derived directly from the underlying nucleotide entry and its accuracy relies on the information provided by the submitter of the nucleotide entry. It is why TrEMBL entries usually have submitted name (SubName) instead of a recommended name (RecName). The description may later be improved by automatic annotation procedures (see section Automatic annotation) but if not, it remains as provided by the submitter until the entry is manually annotated and added to Swiss-Prot.

3.5. The GN lineTable of contents

The GN (Gene Name) line indicates the name(s) of the gene(s) that code for the stored protein sequence. The GN line contains three types of information:

  1. Gene names (a.k.a gene symbols). The name(s) used to represent a gene. As there can be more than one name assigned to a gene, we make a distinction between the one which we believe should be used as the official gene name and the other names which are listed as "Synonyms".
  2. Ordered locus names (a.k.a. OLN, ORF numbers, CDS numbers or Gene numbers). A name used to represent an ORF in a completely sequenced genome or chromosome. It is generally based on a prefix representing the organism and a number which usually represents the sequential ordering of genes on the chromosome. Depending on the genome sequencing center, numbers are only attributed to protein-coding genes, or also to pseudogenes, or also to tRNAs and other features. If two predicted genes have been merged to form a new gene, both gene identifiers are indicated, separated by a slash (see last example). Examples: HI0934, Rv3245c, At5g34500, YER456W, YAR042W/YAR044W.
  3. ORF names (a.k.a. sequencing names or contig names or temporary ORFNames). A name temporarily attributed by a sequencing project to an open reading frame. This name is generally based on a cosmid numbering system. Examples: MtCY277.28c, SYGP-ORF50, SpBC2F12.04, C06E1.1, CG10954.

The format of the GN line is:

GN   Name=<name>; Synonyms=<name1>[, <name2>...]; OrderedLocusNames=<name1>[, <name2>...];
GN   ORFNames=<name1>[, <name2>...];

None of the above four tokens are mandatory. But a "Synonyms" token can only be present if there is a "Name" token.

If there is more than one gene, GN line blocks for the different genes are separated by the following line:

GN   and
Example:
GN   Name=Jon99Cii; Synonyms=SER1, SER5, Ser99Da; ORFNames=CG7877;
GN   and
GN   Name=Jon99Ciii; Synonyms=SER2, SER5, Ser99Db; ORFNames=CG15519;

Wrapping is done preferentially at a semicolon, otherwise at a comma.

It often occurs that more than one name has been assigned to an individual locus, in which case all the synonyms will be listed alphabetically and case- insensitively. Example:

GN   Name=hns; Synonyms=bglY, cur, drdX, hnsA, msyA, osmZ, pilG, topS;
GN   OrderedLocusNames=b1237, c1701, z2013, ECs1739;
3.6. The OS lineTable of contents

The OS (Organism Species) line specifies the organism which was the source of the stored sequence. In the rare case where all the species information will not fit on a single line, more than one OS line is used. The last OS line is terminated by a period.

The species designation consists, in most cases, of the Latin genus and species designation followed by the English name (in parentheses). For viruses, only the common English name is given.

Examples of OS lines are shown here:

OS   Escherichia coli.
OS   Homo sapiens (Human).
OS   Solanum melongena (Eggplant) (Aubergine).
OS   Rous sarcoma virus (strain Schmidt-Ruppin A) (RSV-SRA) (Avian leukosis
OS   virus-RSA).

The names (official name, common name, synonym) concerning one species are cut across lines when they do not fit into a single line:

OS   Epizootic hemorrhagic disease virus 2 (strain Alberta) (EHDV-2).
3.7. The OG lineTable of contents

The OG (OrGanelle) line indicates if the gene coding for a protein originates from mitochondria, a plastid, a nucleomorph or a plasmid.

The format of the OG line is:

OG   Hydrogenosome.
OG   Mitochondrion.
OG   Nucleomorph.
OG   Plasmid name.
OG   Plastid.
OG   Plastid; Apicoplast.
OG   Plastid; Chloroplast.
OG   Plastid; Organellar chromatophore.
OG   Plastid; Cyanelle.
OG   Plastid; Non-photosynthetic plastid.

Where 'name' is the name of the plasmid.

Hydrogenosomes are membrane-enclosed redox organelles found in some anaerobic unicellular eukaryotes which contain hydrogenase and produce hydrogen and ATP by glycolysis. They are thought to have evolved from mitochondria; most hydrogenosomes lack a genome, but some like (e.g. the anaerobic ciliate Nyctotherus ovalis) have retained a rudimentary genome.

Mitochondria are redox-active membrane-bound organelles found in the cytoplasm of most eukaryotic cells. They are the site of sthe reactions of oxidative phosphorylation, which results in the formation of ATP.

Nucleomorphs are reduced vestigal nuclei found in the plastids of cryptomonad and chlorachniophyte algae. The plastids originate from engulfed eukaryotic phototrophs.

Plastids are classified based on either their taxonomic lineage or in some cases on their photosynthetic capacity.

Apicoplasts are the plastids found in Apicocomplexa parasites such as Eimeria, Plasmodium and Toxoplasma; they are not photosynthetic.

Chloroplasts are the plastids found in all land plants and algae with the exception of the glaucocystophyte algae (see below). Chloroplasts in green tissue are photosynthetic; in other tissues they may not be photosynthetic and then may also have secondary information relating to subcellular location (e.g. amyloplasts, chromoplasts).

Organellar chromatophores are the photosynthetic plastids found in Paulinella chromatophora, a photosynthetic thecate amoeba of the Cercozoa lineage. At 1 Mb this plastid is 3 times larger than the largest known plastid; it is not clear if it is derived from the same endosymbiotic event that is thought to have led to all other plastids.

Cyanelles are the plastids found in the glaucocystophyte algae. They are also photosynthetic but their plastid has a vestigial cell wall between the 2 envelope membranes.

Non-photosynthetic plastid is used when the plastid in question derives from a photosynthetic lineage but the plastid in question is missing essential genes. Some examples are Aneura mirabilis, Epifagus virginiana, Helicosporidium (a liverwort, higher plant and green alga respectively).

The term Plastid is used when the capacities of the organism are unclear; for example in the parasitic plants of the Cuscuta lineage, where sometimes young tissue is photosynthetic.

If an entry reports the sequence of a protein identical in a number of plasmids, the names of these plasmids will all be listed in the OG lines of that entry. The plasmid names are separated by commas, the last plasmid name is preceded by the word 'and'. Plasmid names are never written across two lines. Example:

OG   Plasmid R6-5, Plasmid IncFII R100 (NR1), and
OG   Plasmid IncFII R1-19 (R1 drd-19).

The document plasmid.txt lists all the plasmid names that are used in the database in the context of the OG line. The document plastid.txt lists all plastid encoded proteins, with the exception of those encoded in the Paulinella chromatophora chromatophore.

3.8. The OC lineTable of contents

The OC (Organism Classification) lines contain the taxonomic classification of the source organism. The taxonomic classification used is that maintained at the NCBI (see http://www.ncbi.nlm.nih.gov/Taxonomy/) and used by the nucleotide sequence databases (EMBL/GenBank/DDBJ). The NCBI's taxonomy reflects current phylogenetic knowledge. It is a sequence-based taxonomy as much as possible and based on published authorities wherever possible. Because of the inherent ambiguity of evolutionary classification and the specific needs of database users (e.g. trying to track down the phylogenetic history of a group of organisms or to elucidate the evolution of a molecule), this taxonomy strives to accurately reflect current phylogenetic knowledge. The NCBI's taxonomy is intended to be informative and helpful; no claim is made that it is the best or the most exact.

The classification is listed top-down as nodes in a taxonomic tree in which the most general grouping is given first. The classification may be distributed over several OC lines, but nodes are not split or hyphenated between lines. Semicolons separate the individual items and the list is terminated by a period.

The format of the OC line is:

OC   Node[; Node...].

For example the classification lines for a human sequence would be:

OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
OC   Mammalia; Eutheria; Euarchontoglires; Primates; Catarrhini; Hominidae;
OC   Homo.
3.9. The OX lineTable of contents

The OX (Organism taxonomy cross-reference) line is used to indicate the identifier of a specific organism in a taxonomic database. The format of the OX line is:

OX   Taxonomy_database_Qualifier=Taxonomic code;

Currently the cross-references are made to the taxonomy database of NCBI, which is associated with the qualifier 'TaxID' and a one- to six-digit taxonomic code.

Examples:

OX   NCBI_TaxID=9606;
OX   NCBI_TaxID=562;
3.10. The OH lineTable of contents

The OH (Organism Host) line is optional and appears only in viral entries. It indicates the host organism(s) that are susceptible to be infected by a virus.

A virus being an inert particle outside its hosts, the virion has neither metabolism, nor any replication capability, nor autonomous evolution. Identifying the host organism(s) is therefore essential, because features like virus-cell interactions and posttranslational modifications depend mostly on the host.

The format of the OH line is:

OH   NCBI_TaxID=TaxID; HostName.

The HostName consists of the official name and, optionally, a common name and/or synonym. The length of an OH line may exceed 75 characters.

Example for Simian hepatitis A virus:

OH   NCBI_TaxID=9481; Callithrix.
OH   NCBI_TaxID=9536; Cercopithecus hamlyni (Owl-faced monkey) (Hamlyn's monkey).
OH   NCBI_TaxID=9539; Macaca (macaques).
OH   NCBI_TaxID=9598; Pan troglodytes (Chimpanzee).
3.11. The reference (RN, RP, RC, RX, RG, RA, RT, RL) linesTable of contents

These lines comprise the literature citations. The citations indicate the sources from which the data has been abstracted. The reference lines for a given citation occur in a block, and are always in the order RN, RP, RC, RX, RG, RA, RT and RL. Within each such reference block, the RN line occurs once, the RC, RX and RT lines occur zero or more times, and the RP, RG/RA and RL lines occur one or more times. If several references are given, there will be a reference block for each.

An example of a complete reference is:

RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND C), FUNCTION, INTERACTION
RP   WITH PKC-3, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL
RP   STAGE, AND MUTAGENESIS OF PHE-175 AND PHE-221.
RC   STRAIN=Bristol N2;
RX   PubMed=11134024; DOI=10.1074/jbc.M008990200;
RA   Zhang L., Wu S.-L., Rubin C.S.;
RT   "A novel adapter protein employs a phosphotyrosine binding domain and
RT   exceptionally basic N-terminal domains to capture and localize an
RT   atypical protein kinase C: characterization of Caenorhabditis elegans
RT   C kinase adapter 1, a protein that avidly binds protein kinase C3.";
RL   J. Biol. Chem. 276:10463-10475(2001).

The formats of the individual lines are explained below.

3.11.2. The RN line

The RN (Reference Number) line gives a sequential number to each reference citation in an entry. This number is used to indicate the reference in comments and feature table notes. The format of the RN line is:

RN   [n]

where 'n' denotes the nth reference for this entry. The reference number is always between square brackets.

3.11.3. The RP line

The RP (Reference Position) lines describe the extent of the work relevant to the entry carried out by the authors. The format of the RP line is:

RP   COMMENT.

It should contain a description of the information that has been propagated in the Swiss-Prot entry.

A typical comment is "NUCLEOTIDE SEQUENCE". This item might be tagged with a qualifier, indicating the origin of the sequence data. Valid names of this qualifiers are:

  • GENOMIC DNA: the individual gene has been sequenced
  • GENOMIC RNA: the individual gene has been sequenced
  • MRNA: the individual cDNA has been sequenced
  • LARGE SCALE GENOMIC DNA: the gene has been sequenced as part of a genome project
  • LARGE SCALE MRNA: the cDNA has been sequenced as part of a large-scale cDNA project

If 2 qualifiers apply, both are indicated, separated by a '/'.

The 'LARGE SCALE ANALYSIS' is another typical tag added in references that report large screen results to indicate that results have not been extensively studied.

Typical examples of RP lines are shown below:

RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
RP   NUCLEOTIDE SEQUENCE [GENOMIC RNA / MRNA].
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND PROTEIN SEQUENCE OF 21-35.
RP   PROTEIN SEQUENCE OF 39-76; 95-118 AND 125-138, AND DISULFIDE BONDS.
RP   SEQUENCE REVISION TO 76-84 AND 129.
RP   STRUCTURE BY NMR.
RP   X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS).
RP   CHARACTERIZATION.
RP   MUTAGENESIS OF TYR-65.
RP   REVIEW.
RP   VARIANT ALA-1368.
RP   VARIANTS HDLD1 ARG-597 AND ARG-1477, AND VARIANT HDLD2 LEU-693 DEL.
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA], PROTEIN SEQUENCE OF 1-22; 2-17;
RP   240-256; 318-339 AND 381-390, AND CHARACTERIZATION.
RP   NUCLEOTIDE SEQUENCE [MRNA], PROTEIN SEQUENCE OF 154-171; 302-308;
RP   312-328; 377-384 AND 419-431, FUNCTION, SUBCELLULAR LOCATION, AND
RP   MUTAGENESIS OF ARG-331; GLY-332 AND ARG-333.
RP   PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-387 AND SER-391, AND
RP   MASS SPECTROMETRY.
3.11.4. The RC line

The RC (Reference Comment) lines are optional lines which are used to store comments relevant to the reference cited. The format of the RC line is:

RC   TOKEN1=Text; TOKEN2=Text; ...

The currently defined tokens and their order in the RC line are:

STRAIN
PLASMID
TRANSPOSON
TISSUE

Reference comment line topics may span lines. Examples of RC lines:

RC   STRAIN=Sprague-Dawley; TISSUE=Liver;
RC   STRAIN=Holstein; TISSUE=Lymph node, and Mammary gland;
RC   STRAIN=301 / Serotype 2a;
RC   STRAIN=cv. SP753012-O; TISSUE=Leaf;
RC   PLASMID=R1 (R7268); TRANSPOSON=Tn3;
RC   STRAIN=AL.012, AZ.026, AZ.180, DC.005, GA.039, GA2181, IL.014, IL2.17,
RC   IN.018, KY.172, KY2.37, LA.013, MI.035, MN.001, MNb027, MS.040,
RC   NY.016, OH.036, TN.173, TN2.38, UT.002, and VA.015;
3.11.5. The RX line

The RX (Reference cross-reference) line is an optional line which is used to indicate the identifier assigned to a specific reference in a bibliographic database. The format of the RX line is:

RX   Bibliographic_db=IDENTIFIER[; Bibliographic_db=IDENTIFIER...];

Where the valid bibliographic database names and their associated identifiers are:

 Name  Identifier
 MEDLINE  Eight-digit MEDLINE Unique Identifier (UI)
 PubMed  PubMed Unique Identifier (PMID)
 DOI  Digital Object Identifier (DOI)
 AGRICOLA  AGRICOLA Unique Identifier

Example of RX lines:

RX   MEDLINE=83283433; PubMed=6688356;
RX   PubMed=15626370; DOI=10.1016/j.toxicon.2004.10.011;
RX   MEDLINE=22709107; PubMed=12788972; DOI=10.1073/pnas.1130426100;
RX   AGRICOLA=IND20551642; DOI=10.1007/BF00224104;
3.11.6. The RG line

The Reference Group (RG) line lists the consortium name associated with a given citation. The RG line is mainly used in submission reference blocks, but can also be used in paper references, if the working group is cited as an author in the paper. RG line and RA line (Reference Author) can be present in the same reference block; at least one RG or RA line is mandatory per reference block. An example of the use of RG lines is shown below:

RG   The mouse genome sequencing consortium;
3.11.7. The RA line

The RA (Reference Author) lines list the authors of the paper (or other work) cited. The RA line is present in most references, but might be missing in references that cite a reference group (see RG line). At least one RG or RA line is mandatory per reference block.

All of the authors are included, and are listed in the order given in the paper. The names are listed surname first followed by a blank, followed by initial(s) with periods. The authors' names are separated by commas and terminated by a semicolon. Author names are not split between lines. An example of the use of RA lines is shown below:

RA   Galinier A., Bleicher F., Negre D., Perriere G., Duclos B.,
RA   Cozzone A.J., Cortay J.-C.;

As many RA lines as necessary are included in each reference. All initials of the author names are indicated and hyphens between initials are kept.

An author's initials can be followed by an abbreviation such as 'Jr' (for Junior), 'Sr' (Senior), 'II', 'III' or 'IV' (2nd, 3rd and 4th). Example:

RA   Nasoff M.S., Baker H.V. II, Wolf R.E. Jr.;
3.11.8. The RT line

The RT (Reference Title) lines give the title of the paper (or other work) cited as exactly as possible given the limitations of the computer character set. The format of the RT line is:

RT   "Title.";

Example of a set of RT lines:

RT   "New insulin-like proteins with atypical disulfide bond pattern
RT   characterized in Caenorhabditis elegans by comparative sequence
RT   analysis and homology modeling.";

It should be noted that the format of the title is not always identical to that displayed at the top of the published work:

  • Major title words are not capitalized;
  • The text of a title ends with either a period '.', a question mark '?' or an exclamation mark '!';
  • Double quotation marks ' " ' in the text of the title are replaced by single quotation marks;
  • Titles of articles published in a language other than English have been translated into English;
  • Greek letters are written in full (alpha, beta, etc.).
3.11.9. The RL line

The RL (Reference Location) lines contain the conventional citation information for the reference. In general, the RL lines alone are sufficient to find the paper in question.

a) Journal citations

The RL line for a journal citation includes the journal abbreviation, the volume number, the page range and the year. The format for such an RL line is:

RL   Journal_abbrev Volume:First_page-Last_page(YYYY).

Journal names are abbreviated according to the conventions used by the National Library of Medicine (NLM) and are based on the existing ISO and ANSI standards. A list of the abbreviations currently in use is given in the document file jourlist.txt

An example of an RL line is:

RL   J. Mol. Biol. 168:321-331(1983).

When a reference is made to a paper which is 'in press' at the time the database is released, the page range, and possibly the volume number, are indicated as '0' (zero). An example of such an RL line is shown here:

RL   Int. J. Parasitol. 0:0-0(2005).
b) Electronic publications

The RL line for an electronic publication includes an '(er)' prefix. The format is indicated below:

RL   (er) Free text.

Examples:

RL   (er) Plant Gene Register PGR98-023.
RL   (er) Worm Breeder's Gazette 15(3):34(1998).
c) Book citations

A variation of the RL line format is used for papers found in books or other types of publication, which are then cited using the following format:

RL   (In) Editor_1 I.[, Editor_2 I., Editor_X I.] (eds.);
RL   Book_name, pp.[Volume:]First_page-Last_page, Publisher, City (YYYY).

Examples:

RL   (In) Boyer P.D. (eds.);
RL   The enzymes (3rd ed.), pp.11:397-547, Academic Press, New York (1975).
RL   (In) Rich D.H., Gross E. (eds.);
RL   Proceedings of the 7th American peptide symposium, pp.69-72, Pierce
RL   Chemical Co., Rockford Il. (1981).
RL   (In) Magnusson S., Ottesen M., Foltmann B., Dano K., Neurath H.
RL   (eds.);
RL   Regulatory proteolytic enzymes and their inhibitors, pp.163-172,
RL   Pergamon Press, New York (1978).
d) Unpublished observations

For unpublished observations the format of the RL line is:

RL   Unpublished observations (MMM-YYYY).

Where 'MMM' is the month and 'YYYY' is the year.

We use the 'unpublished observations' RL line to cite communications by scientists to Swiss-Prot of unpublished information concerning various aspects of a sequence entry.

e) Thesis

For Ph.D. theses the format of the RL line is:

RL   Thesis (Year), Institution_name, Country.

An example of such a line is given here:

RL   Thesis (1977), University of Geneva, Switzerland.
f) Patent applications

For patent applications the format of the RL line is:

RL   Patent number Pat_num, DD-MMM-YYYY.

Where 'Pat_num' is the international publication number of the patent, 'DD' is the day, 'MMM' is the month and 'YYYY' is the year. Example:

RL   Patent number WO9010703, 20-SEP-1990.
g) Submissions

The final form that an RL line can take is that used for submissions. The format of such an RL line is:

RL   Submitted (MMM-YYYY) to Database_name.

Where 'MMM' is the month, 'YYYY' is the year and 'Database_name' is one of the following:

the EMBL/GenBank/DDBJ databases
UniProtKB
the PDB data bank
the PIR data bank

Two examples of submission RL lines are given here:

RL   Submitted (OCT-1995) to the EMBL/GenBank/DDBJ databases.
RL   Submitted (APR-2004) to UniProtKB.
3.12. The CC lineTable of contents

The CC lines are free text comments on the entry, and are used to convey any useful information. The comments always appear below the last reference line and are grouped together in comment blocks; a block is made up of 1 or more comment lines. The first line of a block starts with the characters '-!-'.

The format of a comment block is:

CC   -!- TOPIC: First line of a comment block;
CC       second and subsequent lines of a comment block.

The comment blocks are arranged according to what we designate as 'topics'. The current topics and their definitions are listed in the table below.

Topic Description
ALLERGEN Information relevant to allergenic proteins
ALTERNATIVE PRODUCTS Description of the existence of related protein sequence(s) produced by alternative splicing of the same gene, alternative promoter usage, ribosomal frameshifting or by the use of alternative initiation codons; see 3.22.16
BIOPHYSICOCHEMICAL PROPERTIES Description of the information relevant to biophysical and physicochemical data and information on pH dependence, temperature dependence, kinetic parameters, redox potentials, and maximal absorption; see 3.22.8
BIOTECHNOLOGY Description of the use of a specific protein in a biotechnological process
CATALYTIC ACTIVITY Description of the reaction(s) catalyzed by an enzyme [1]
CAUTION Warning about possible errors and/or grounds for confusion
COFACTOR Description of any non-protein substance required by an enzyme for its catalytic activity
DEVELOPMENTAL STAGE Description of the developmentally-specific expression of mRNA or protein
DISEASE Description of the disease(s) associated with a deficiency of a protein
DISRUPTION PHENOTYPE Description of the effects caused by the disruption of the gene coding for the protein; see 3.22.28
DOMAIN Description of the domain structure of a protein
ENZYME REGULATION Description of an enzyme regulatory mechanism
FUNCTION General description of the function(s) of a protein
INDUCTION Description of the compound(s) or condition(s) that regulate gene expression
INTERACTION Conveys information relevant to binary protein-protein interaction 3.22.12
MASS SPECTROMETRY Reports the exact molecular weight of a protein or part of a protein as determined by mass spectrometric methods; see 3.22.24
MISCELLANEOUS Any comment which does not belong to any of the other defined topics
PATHWAY Description of the metabolic pathway(s) with which a protein is associated
PHARMACEUTICAL Description of the use of a protein as a pharmaceutical drug
POLYMORPHISM Description of polymorphism(s)
PTM Description of any chemical alternation of a polypeptide (proteolytic cleavage, amino acid modifications including crosslinks). This topic complements information given in the feature table or indicates polypeptide modifications for which position-specific data is not available.
RNA EDITING Description of any type of RNA editing that leads to one or more amino acid changes
SEQUENCE CAUTION Description of protein sequence reports that differ from the sequence that is shown in UniProtKB due to conflicts that are not described in FT CONFLICT lines, such as frameshifts, erroneous gene model predictions, etc. See 3.22.37
SIMILARITY Description of the similaritie(s) (sequence or structural) of a protein with other proteins
SUBCELLULAR LOCATION Description of the subcellular location of the chain/peptide/isoform.
SUBUNIT Description of the quaternary structure of a protein and any kind of interactions with other proteins or protein complexes; except for receptor-ligand interactions, which are described in the topic FUNCTION.
TISSUE SPECIFICITY Description of the tissue-specific expression of mRNA or protein
TOXIC DOSE Description of the lethal dose (LD), paralytic dose (PD) or effective dose of a protein
WEB RESOURCE Description of a cross-reference to a network database/resource for a specific protein; see 3.22.39

Note:

[1] For the 'CATALYTIC ACTIVITY' topic: To describe the catalytic activity of an enzyme we have used, whenever possible, the recommendations of the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology (IUBMB) as published in Enzyme Nomenclature, NC-IUBMB, Academic Press, New-York, (1992).

Each entry contains a variable number of CC line topics. Most topics can be present more than once in a given entry. Topics that occur only once in an entry are: ALLERGEN, ALTERNATIVE PRODUCTS, BIOPHYSICOCHEMICAL PROPERTIES, BIOTECHNOLOGY, DEVELOPMENTAL STAGE, DISRUPTION PHENOTYPE, ENZYME REGULATION, INDUCTION, INTERACTIONS, PHARMACEUTICAL, SUBUNIT, TISSUE SPECIFICITY, TOXIC DOSE and RNA EDITING.

3.12.1. Examples for each comment line topic

We show here, for each of the defined topics, two examples of their usage:

CC   -!- ALLERGEN: Causes an allergic reaction in human. Binds to IgE.
CC       Partially heat-labile allergen that may cause both respiratory and
CC       food-allergy symptoms in patients with the bird-egg syndrome.
CC   -!- ALLERGEN: Causes an allergic reaction in human. Minor allergen of
CC       bovine dander.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=3;
CC         Comment=Additional isoforms seem to exist. Experimental
CC         confirmation may be lacking for some isoforms;
CC       Name=1; Synonyms=AIRE-1;
CC         IsoId=O43918-1; Sequence=Displayed;
CC       Name=2; Synonyms=AIRE-2;
CC         IsoId=O43918-2; Sequence=VSP_004089;
CC       Name=3; Synonyms=AIRE-3;
CC         IsoId=O43918-3; Sequence=VSP_004089, VSP_004090;
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative initiation; Named isoforms=2;
CC       Name=Alpha;
CC         IsoId=P51636-1; Sequence=Displayed;
CC       Name=Beta;
CC         IsoId=P51636-2; Sequence=VSP_018696;
CC   -!- BIOPHYSICOCHEMICAL PROPERTIES:
CC       pH dependence:
CC         Optimum pH is 8-10;
CC       Temperature dependence:
CC         Highly active at low temperatures, even at 0 degree Celsius.
CC         Thermolabile;
CC   -!- BIOPHYSICOCHEMICAL PROPERTIES:
CC       Kinetic parameters:
CC         KM=98 uM for ATP;
CC         KM=688 uM for pyridoxal;
CC         Vmax=1.604 mmol/min/mg enzyme;
CC       pH dependence:
CC         Optimum pH is 6.0. Active from pH 4.5 to 10.5;
CC   -!- BIOTECHNOLOGY: The effect of PG can be neutralized by introducing
CC       an antisense PG gene by genetic manipulation. The Flavr Savr
CC       tomato produced by Calgene (Monsanto) in such a manner has a
CC       longer shelf life due to delayed ripening.
CC   -!- BIOTECHNOLOGY: Used in the food industry for high temperature
CC       liquefaction of starch-containing mashes and in the detergent
CC       industry to remove starch. Sold under the name Termamyl by
CC       Novozymes.
CC   -!- CATALYTIC ACTIVITY: ATP + L-glutamate + NH(3) = ADP + phosphate +
CC       L-glutamine.
CC   -!- CATALYTIC ACTIVITY: (R)-2,3-dihydroxy-3-methylbutanoate + NADP(+)
CC       = (S)-2-hydroxy-2-methyl-3-oxobutanoate + NADPH.
CC   -!- CAUTION: It is uncertain whether Met-1 or Met-3 is the initiator.
CC   -!- COFACTOR: Pyridoxal phosphate.
CC   -!- COFACTOR: FAD (By similarity).
CC   -!- WEB RESOURCE: Name=Alzheimer Research Forum; Note=APP mutations;
CC       URL="http://www.alzforum.org/res/com/mut/app/default.asp".
CC   -!- DEVELOPMENTAL STAGE: Expressed early during conidial (dormant
CC       spores) differentiation.
CC   -!- DEVELOPMENTAL STAGE: Detected in embryonic skin (E12.5 and E14.5)
CC       during the formation of hair follicles and at E15.5 in the enamel
CC       knot of the developing tooth. Detected in the basal layer of the
CC       epidermis and hair follicles of P2 mice.
CC   -!- DISEASE: Defects in PHKA1 are linked to X-linked muscle
CC       glycogenosis [MIM:311870]. It is a disease characterized by slowly
CC       progressive, predominantly distal muscle weakness and atrophy.
CC   -!- DISEASE: Defects in ABCD1 are the cause of recessive X-linked
CC       adrenoleukodystrophy (X-ALD) [MIM:300100]. X-ALD is a rare
CC       peroxisomal metabolic disorder that occurs in boys and is
CC       characterized by progressive multifocal demyelination of the
CC       central nervous system and by adrenocortical insufficiency. It
CC       produces mental deterioration, corticospinal tract dysfunction,
CC       and cortical blindness. There is laboratory evidence of adrenal
CC       cortical dysfunction. Different clinical manifestations exist
CC       like: cerebral childhood ALD (CALD), adult cerebral ALD (ACALD),
CC       adrenomyeloneuropathy (AMN) and "Addison disease only" (ADO)
CC       phenotype.
CC   -!- DISRUPTION PHENOTYPE: Mice display impaired B-cell development
CC       which does not progress pass the progenitor stage.
CC   -!- DISRUPTION PHENOTYPE: Death before reaching adulthood, probably
CC       due to lethal epilepsy. Mice display severe defects in the
CC       olfactory bulbs, the hippocampus, and the cerebellum. These
CC       defects appear to result from impaired cytokinesis followed by the
CC       induction of apoptosis in specific neuroblast populations.
CC   -!- DOMAIN: Contains a coiled-coil domain essential for vesicular
CC       transport and a dispensable C-terminal region.
CC   -!- DOMAIN: The B chain is composed of two domains, each domain
CC       consists of 3 homologous subdomains (alpha, beta, gamma).
CC   -!- ENZYME REGULATION: The activity of this enzyme is controlled by
CC       adenylation under conditions of abundant glutamine. The fully
CC       adenylated enzyme complex is inactive (By similarity).
CC   -!- ENZYME REGULATION: Activated by Gram-negative bacterial
CC       lipopolysaccharides and chymotrypsin.
CC   -!- FUNCTION: Binds to actin and affects the structure of the
CC       cytoskeleton. At high concentrations, profilin prevents the
CC       polymerization of actin, whereas it enhances it at low
CC       concentrations. By binding to PIP2, it inhibits the formation of
CC       IP3 and DG.
CC   -!- FUNCTION: Inhibitor of fungal polygalacturonase. It is an
CC       important factor for plant resistance to phytopathogenic fungi.
CC       Substrate preference is polygalacturonase (PG) from A.niger >> PG
CC       of F.oxysporum, A.solani or B.cinerea. Not active on PG from
CC       F.moniliforme.
CC   -!- INDUCTION: By heat shock, salt stress, oxidative stress, glucose
CC       limitation and oxygen limitation.
CC   -!- INDUCTION: By infection, plant wounding, or elicitor treatment of
CC       cell cultures.
CC   -!- INTERACTION:
CC       Self; NbExp=1; IntAct=EBI-123485, EBI-123485;
CC       Q9W158:CG4612; NbExp=1; IntAct=EBI-123485, EBI-89895;
CC       Q9VYI0:fne; NbExp=1; IntAct=EBI-123485, EBI-126770;
CC   -!- INTERACTION:
CC       Q9W1K5-1:CG11299; NbExp=1; IntAct=EBI-133844, EBI-212772;
CC   -!- MASS SPECTROMETRY: Mass=24948; Mass_error=6; Method=MALDI;
CC       Range=1-228; Source=PubMed:11101899;
CC   -!- MASS SPECTROMETRY: Mass=13822; Method=MALDI; Range=19-140 (P15522-
CC       2); Source=PubMed:10531593;
CC   -!- MISCELLANEOUS: Binds to bacitracin.
CC   -!- MISCELLANEOUS: Called DUO because the encoded protein is closely
CC       related to but shorter than TRIO.
CC   -!- PATHWAY: Cofactor biosynthesis; porphyrin biosynthesis; 5-
CC       aminolevulinate from L-glutamyl-tRNA(Glu): step 2/2.
CC   -!- PATHWAY: Nucleotide metabolism; purine metabolism.
CC   -!- PHARMACEUTICAL: Available under the names Avonex (Biogen),
CC       Betaseron (Berlex) and Rebif (Serono). Used in the treatment of
CC       multiple sclerosis (MS). Betaseron is a slightly modified form of
CC       IFNB1 with two residue substitutions.
CC   -!- PHARMACEUTICAL: Available under the name Proleukin (Chiron). Used
CC       in patients with renal cell carcinoma or metastatic melanoma.
CC   -!- POLYMORPHISM: The allelic form of the enzyme with Gln-191
CC       (Allozyme A) hydrolyzes paraoxon with a low turnover number and
CC       the one with Arg-191 (Allozyme B) with a high turnover number.
CC   -!- POLYMORPHISM: In the human populations there are two major allelic
CC       forms, alpha-1 with 83 residues and alpha-2 with 142 residues.
CC       These alleles determine the 3 major phenotypes HP*1F/HP*1S and
CC       HP*2FS. The two main alleles of HP*1 are called HP*1F (fast) and
CC       HP*1S (slow).
CC   -!- PTM: N-glycosylated and probably also O-glycosylated.
CC   -!- PTM: A soluble short 95 kDa form may be released by proteolytic
CC       cleavage from the long membrane-anchored form.
CC   -!- RNA EDITING: Modified_positions=393, 431, 452, 495.
CC   -!- RNA EDITING: Modified_positions=59, 78, 94, 98, 102, 121; Note=The
CC       nonsense codon at position 59 is modified to a sense codon. The
CC       stop codon at position 121 is created by RNA editing.
CC   -!- SEQUENCE CAUTION:
CC       Sequence=CAI24940.1; Type=Erroneous gene model prediction;
CC   -!- SIMILARITY: Belongs to the annexin family.
CC   -!- SIMILARITY: Contains 13 EGF-like domains.
CC   -!- SUBCELLULAR LOCATION: Bacterial cell inner membrane; Multi-pass
CC       membrane protein.
CC   -!- SUBUNIT: Homotetramer.
CC   -!- SUBUNIT: Disulfide-linked heterodimer of a light chain (L) and a
CC       heavy chain (H). The light chain has the pharmacological activity,
CC       while the N- and C-terminal of the heavy chain mediate channel
CC       formation and toxin binding, respectively.
CC   -!- TISSUE SPECIFICITY: Shoots, roots, and cotyledon from dehydrating
CC       seedlings.
CC   -!- TISSUE SPECIFICITY: Expressed at high levels in brain and ovary.
CC       Lower levels in small intestine. In brain regions, detected in all
CC       regions tested. Highest levels in the cerebellum and cerebral
CC       cortex.
CC   -!- TOXIC DOSE: PD(50) is 1.72 mg/kg by injection in blowfly larvae.
CC   -!- TOXIC DOSE: LD(50) is 0.015 mg/kg by intravenous injection for
CC       sarafotoxin-A and sarafotoxin-B, and 0.3 mg/kg for sarafotoxin-C.
CC   -!- WEB RESOURCE: Name=CD40Lbase;
CC       Note=European CD40L defect database (mutation db);
CC       URL="http://www.expasy.org/cd40lbase/".
3.12.2. Syntax of the topic 'BIOPHYSICOCHEMICAL PROPERTIES'
CC   -!- BIOPHYSICOCHEMICAL PROPERTIES:
CC       Absorption:
CC         Abs(max)=xx nm;
CC         Note=free_text;
CC       Kinetic parameters:
CC         KM=xx unit for substrate [(free_text)];
CC         Vmax=xx unit enzyme [free_text];
CC         Note=free_text;
CC       pH dependence:
CC         free_text;
CC       Redox potential:
CC         free_text;
CC       Temperature dependence:
CC         free_text;

A BIOPHYSICOCHEMICAL PROPERTIES block must contain at least one of the properties Absorption, Kinetic parameters, pH dependence, Redox potential, Temperature dependence and may have any combination of these properties (ordered as indicated above). The meaning of these subtopics is as follows:

Property Description
Absorption indicates the wavelength at which photoreactive proteins such as opsins and DNA photolyases show maximal absorption
Kinetic parameters mentions the Michaelis-Menten constant (KM) and maximal velocity (Vmax) of enzymes
pH dependence describes the optimum pH for enzyme activity and/or the variation of enzyme activity with pH variation
Redox potential reports the value of the standard (midpoint) oxido-reduction potential(s) for electron transport proteins
Temperature dependence indicates the optimum temperature for enzyme activity and/or the variation of enzyme activity with temperature variation; the thermostability/thermolability of the enzyme is also mentioned when it is known
3.12.3. The topic 'INTERACTION'

The CC line topic INTERACTION conveys information relevant to binary protein-protein interaction. It is automatically derived from the IntAct database and is updated on a monthly basis. The occurrence is one INTERACTION topic per entry, with each binary interaction being presented in a separate line. Each data line can be longer than 75 characters.

Interactions can be derived by any appropriate experimental method, but must be confirmed by a second experiment, if resulting from a single yeast- two-hybrid experiment. For large-scale experiments, interactions are considered if a high confidence is assigned from the authors.

The format of the CC line topic INTERACTION is:

CC   -!- INTERACTION:
CC       {{SP_Ac:identifier[ (xeno)]}|Self}; NbExp=n; IntAct=IntAct_Protein_Ac, IntAct_Protein_Ac;

where

SP_Ac is the Swiss-Prot or TrEMBL accession number of the interacting protein. If appropriate, the IsoId is used instead to specify the relevant interacting protein isoform.
identifier serves to describe the interacting protein. It is derived from the Swiss-Prot or TrEMBL GN line and thus presents either a "gene name", a "ordered locus name" or a "ORF name". When no GN line is available a dash is indicated instead.
(xeno) is an optional qualifier indicating that the interacting proteins are derived from different species. This may be due to the experimental set-up or may reflect a pathogen-host interaction.
Self reflects a self-association; the corresponding current entry's SP_Ac and 'identifier' are not given/repeated.
NbExp=n refers to the number of experiments in IntAct supporting the interaction.
IntAct_Protein_Ac is the IntAct accession number of a interacting protein. The first IntAct_Protein_Ac refers to the protein or an isoform of the current entry, the second refers to the interacting protein or isoform.

Within the CC INTERACTION topic, homomeric interactions are listed before the heteromeric interactions; latter are sorted alphanumerical according the 'identifier'.

"IntAct=IntAct_Protein_Ac, IntAct_Protein_Ac" identifies the interaction in IntAct by using the two IntAct protein identifiers.

Examples of interaction lines are given below. The CC INTERACTION topics are not complete; only explained interaction lines are indicated.

CC   -!- INTERACTION:
CC       P11450:fcp3c; NbExp=1; IntAct=EBI-126914, EBI-159556;

In the typical example the current protein is interacting with P11450 which is further characterized by "fcp3c" derived from its GN line and presents its gene name "Fcp3C". The interaction is supported by one experiment stored in IntAct. Experimental details for this interaction can be found by querying IntAct with "EBI-126914, EBI-159556".


CC   -!- INTERACTION:
CC       Q9W1K5-1:CG11299; NbExp=1; IntAct=EBI-133844, EBI-212772;

The current protein interacts with an isoform of Q9W1K5 defined by the IsoID Q9W1K5-1 .


CC   -!- INTERACTION:
CC       Q8NI08:-; NbExp=1; IntAct=EBI-80809, EBI-80799;

No gene name information for the interacting protein is available.


CC   -!- INTERACTION:
CC       Self; NbExp=1; IntAct=EBI-123485, EBI-123485;

The protein self-associates.


CC   -!- INTERACTION:
CC       Q8C1S0:2410018M14Rik (xeno); NbExp=1; IntAct=EBI-394562, EBI-398761;

The source organisms of the interacting proteins are different.


CC   -!- INTERACTION:
CC       P51617:IRAK1; NbExp=1; IntAct=EBI-448466, EBI-358664;
CC       P51617:IRAK1; NbExp=1; IntAct=EBI-448472, EBI-358664;

Different isoforms of the current protein are shown to interact with the same protein (P51617). This is reflected by different IntAct_Protein_Acs for the current protein.

Example entry with many interaction lines: Q02821.

3.12.4. Syntax of the topic 'SUBCELLULAR LOCATION'

The document subcell.txt, lists the controlled vocabularies used in the comment line (CC) topic SUBCELLULAR LOCATION, their definitions and further information such as synonyms or relevant GO terms in the following format:

    ---------  -------------------------------   ----------------------------------------------
    Line code  Content                           Occurrence in an entry
    ---------  -------------------------------   ----------------------------------------------
    ID         Identifier (location)             Once; starts an entry
    IT         Identifier (topology)             Once; starts a 'topology' entry
    IO         Identifier (orientation)          Once; starts an 'orientation' entry
    AC         Accession (SL-xxxx)               Once
    DE         Definition                        Once or more
    SY         Synonyms                          Optional; Once or more
    SL         Content of subc. loc. lines       Once
    HI         Hierarchy ('is-a')                Optional; Once or more
    HP         Hierarchy ('part-of')             Optional; Once or more
    KW         Associated keyword (accession)    Optional; Once or more
    GO         Gene ontology (GO) mapping        Optional; Once or more
    WW         Interesting links or references   Optional; Once or more
    //         Terminator                        Once; ends an entry
    
   

Example:

    ID   Cyanelle.
    AC   SL-0082
    DE   A cyanelle is a photosynthetic organelle of glaucocystophyte algae.
    DE   Cyanelles are surrounded by a double membrane and, in between, a
    DE   peptidoglycan wall. Thylakoid membrane architecture and the presence
    DE   of carboxysomes are cyanobacteria-like. Historically, the term
    DE   cyanelle is derived from a classification as endosymbiotic
    DE   cyanobacteria, and thus is not fully correct.
    SY   Muroplast; Cyanoplast.
    SL   Plastid, cyanelle.
    HI   Plastid.
    KW   KW-0194
    GO   GO:0009842; cyanelle
    //
   

The format of SUBCELLULAR LOCATION is:

       CC   -!- SUBCELLULAR LOCATION:(( Molecule:)?( Location\.)+)?( Note=Free_text( Flag)?\.)?
   
Where:
  • Molecule: Isoform, chain or peptide name
  • Location = Subcellular_location( Flag)?(; Topology( Flag)?)?(; Orientation( Flag)?)?
    • Subcellular_location: SL-line of subcell.txt ID-record
    • Topology: SL-line of subcell.txt IT-record
    • Orientation: SL-line of subcell.txt IO-record
    • Flag = \(By similarity|Probable|Potential\)

Note: Perl-style multipliers indicate whether a pattern (as delimited by parentheses) is optional (?) or may occur 1 or more times (+).

Examples:

When no chain/peptide/isoform is specified, the subcellular location corresponds to that of the mature protein.

    CC   -!- SUBCELLULAR LOCATION: Cytoplasm. Endoplasmic reticulum membrane;
    CC       Peripheral membrane protein. Golgi apparatus membrane; Peripheral
    CC       membrane protein.
   
    CC   -!- SUBCELLULAR LOCATION: Cell membrane; Peripheral membrane protein
    CC       (By similarity). Secreted (By similarity). Note=The last 22 C-
    CC       terminal amino acids may participate in cell membrane attachment.
    CC   -!- SUBCELLULAR LOCATION: Isoform 2: Cytoplasm (Probable).
   
    CC   -!- SUBCELLULAR LOCATION: Golgi apparatus, trans-Golgi network
    CC       membrane; Multi-pass membrane protein (By similarity).
    CC       Note=Predominantly found in the trans-Golgi network (TGN). Not
    CC       redistributed to the plasma membrane in response to elevated
    CC       copper levels.
    CC   -!- SUBCELLULAR LOCATION: Isoform 2: Cytoplasm.
    CC   -!- SUBCELLULAR LOCATION: WND/140 kDa: Mitochondrion.
   
3.12.5. Syntax of the topic 'ALTERNATIVE PRODUCTS'

The format of the CC line topic ALTERNATIVE PRODUCTS is:

 CC   -!- ALTERNATIVE PRODUCTS:
 CC       Event=Event(, Event)*; Named isoforms=Number_of_isoforms;
(CC         Comment=Free_text;)?
(CC       Name=Isoform_name;( Synonyms=Synonym(, Synonym)*;)?
 CC         IsoId=Isoform_identifier(, Isoform_identifer)*;
 CC         Sequence=(Displayed|External|Not described|Feature_identifier(, Feature_identifier)*);
(CC         Note=Free_text;)?)+

Note: Variable values are represented in italics. Perl-style multipliers indicate whether a pattern (as delimited by parentheses) is optional (?), may occur 0 or more times (*), or 1 or more times (+). Alternative values are separated by a pipe symbol (|).

Topic Description
Event Biological process that results in the production of the alternative forms. It lists one or a combination of the following values (Alternative promoter usage, Alternative splicing, Alternative initiation, Ribosomal frameshifting).
Format: Event=controlled vocabulary;
Example: Event=Alternative splicing;
Named isoforms Number of isoforms listed in the topics 'Name' currently only for 'Event=Alternative splicing'.
Format: Named isoforms=number;
Example: Named isoforms=6;
Comment Any comments concerning one or more isoforms; optional;
Format: Comment=free text;
Example: Comment=Experimental confirmation may be lacking for some isoforms;
Name A common name for an isoform used in the literature or assigned by Swiss-Prot; currenty only available for spliced isoforms.
Format: Name=common name;
Example: Name=Alpha;
Synonyms Synonyms for an isoform as used in the literature; optional; currently only available for spliced isoforms.
Format: Synonyms=Synonym_1[, Synonym_n];
Example: Synonyms=B, KL5;
IsoId Unique identifier for an isoform, consisting of the Swiss-Prot accession number, followed by a dash and a number.
Format: IsoId=acc#-isoform_number[, acc#-isoform_number];
Example: IsoId=P05067-1;
Sequence Information on the isoform sequence; the term 'Displayed' indicates, that the sequence is shown in the entry; a lists of feature identifiers (VSP_#) indicates that the isoform is annotated in the feature table; the FTIds enable programs to create the sequence of a splice variant; if the accession number of the IsoId does not correspond to the accession number of the current entry, this topic contains the term 'External'; 'Not described' points out that the sequence of the isoform is unknown.
Format: Sequence=VSP_#[, VSP_#]|Displayed|External|Not described;
Example: Sequence=Displayed;
Example: Sequence=VSP_000013, VSP_000014; Example: Sequence=External;
Example: Sequence=Not described;
Note Lists isoform-specific information; optional. It may specify the event(s), if there are several.
Format: Note=Free text;
Example: Note=No experimental confirmation available;

Example of the CC lines and the corresponding FT lines for an entry with alternative splicing:

CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing, Alternative initiation; Named isoforms=8;
CC         Comment=Additional isoforms seem to exist;
CC       Name=1; Synonyms=Non-muscle isozyme;
CC         IsoId=Q15746-1; Sequence=Displayed;
CC       Name=2;
CC         IsoId=Q15746-2; Sequence=VSP_004791;
CC       Name=3A;
CC         IsoId=Q15746-3; Sequence=VSP_004792, VSP_004794;
CC       Name=3B;
CC         IsoId=Q15746-4; Sequence=VSP_004791, VSP_004792, VSP_004794;
CC       Name=4;
CC         IsoId=Q15746-5; Sequence=VSP_004792, VSP_004793;
CC       Name=Del-1790;
CC         IsoId=Q15746-6; Sequence=VSP_004795;
CC       Name=5; Synonyms=Smooth-muscle isozyme;
CC         IsoId=Q15746-7; Sequence=VSP_018845;
CC         Note=Produced by alternative initiation at Met-923 of isoform 1;
CC       Name=6; Synonyms=Telokin;
CC         IsoId=Q15746-8; Sequence=VSP_018846;
CC         Note=Produced by alternative initiation at Met-1761 of isoform
CC         1. Has no catalytic activity;
...
FT   VAR_SEQ       1   1760       Missing (in isoform 6).
FT                                /FTId=VSP_018846.
FT   VAR_SEQ       1    922       Missing (in isoform 5).
FT                                /FTId=VSP_018845.
FT   VAR_SEQ     437    506       VSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKA
FT                                RTRDSGTYSCTASNAQGQVSCSWTLQVER -> G (in
FT                                isoform 2 and isoform 3B).
FT                                /FTId=VSP_004791.
FT   VAR_SEQ    1433   1439       DEVEVSD -> MKWRCQT (in isoform 3A,
FT                                isoform 3B and isoform 4).
FT                                /FTId=VSP_004792.
FT   VAR_SEQ    1473   1545       Missing (in isoform 4).
FT                                /FTId=VSP_004793.
FT   VAR_SEQ    1655   1705       Missing (in isoform 3A and isoform 3B).
FT                                /FTId=VSP_004794.
FT   VAR_SEQ    1790   1790       Missing (in isoform Del-1790).
FT                                /FTId=VSP_004795.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing, Alternative initiation; Named isoforms=3;
CC         Comment=Isoform 1 and isoform 2 arise due to the use of two
CC         alternative first exons joined to a common exon 2 at the same
CC         acceptor site but in different reading frames, resulting in two
CC         completely different isoforms;
CC       Name=1; Synonyms=p16INK4a;
CC         IsoId=O77617-1; Sequence=Displayed;
CC       Name=3;
CC         IsoId=O77617-2; Sequence=VSP_018701;
CC         Note=Produced by alternative initiation at Met-35 of isoform 1.
CC         No experimental confirmation available;
CC       Name=2; Synonyms=p19ARF;
CC         IsoId=O77618-1; Sequence=External;
..
FT   VAR_SEQ       1     34       Missing (in isoform 3).
FT                                /FTId=VSP_004099.
3.12.6. Syntax of the topic 'MASS SPECTROMETRY'
CC   -!- MASS SPECTROMETRY: Mass=mass(; Mass_error=error)?; Method=method; Range=ranges( (IsoformID))?(; Note=free_text)?; Source=references;

Where:

  • 'Mass=XXX' is the determined molecular weight (MW);
  • 'Mass_error=XX' (optional) is the accuracy or error range of the MW measurement;
  • 'Method=XX' is the ionization method;
  • 'Range=XX-XX[ (Name)]' is used to indicate what part of the protein sequence entry corresponds to the molecular weight. In case of multiple products, the name of the relevant isoform is enclosed;
  • 'Note={Free text}'. Comment in free text format;
  • 'Source=PubMed:/Ref.n' indicates the relevant reference'.
3.12.7. DISRUPTION PHENOTYPE

Note that we only describe effects caused the complete absence of a gene and thus a protein in vivo (null mutants caused by random or target deletions, insertions of a transposable element etc.) To avoid description of phenotypes due to partial or dominant negative mutants, missense mutations are not described in this comment, but in FT MUTAGEN instead. Defects caused by transient inactivation by methods such as RNA interference (RNAi) or blockage by antibodies are not described in this comment due to the difficulty to interpret results, except for C. elegans RNAi studies, which are widely used and done in vivo.

3.12.8. Syntax of the topic 'SEQUENCE CAUTION'

The format of the SEQUENCE CAUTION topic is:

CC   -!- SEQUENCE CAUTION:
         Sequence=Sequence; Type=Type;[ Positions=Positions;][ Note=Note;]

Where:

  • Sequence is the sequence which differs from the UniProtKB sequence. It is described by one of:
    • an EMBL protein identifier (with version number)
    • an EMBL accession number.
    • a literature reference (e.g. Ref.3).
  • Type describes the cause for the sequence difference(s) and is one of:
    • Frameshift
    • Erroneous initiation
    • Erroneous termination
    • Erroneous gene model prediction
    • Erroneous translation
    • Miscellaneous discrepancy
  • Positions describes the sequence position(s) or range(s) of the difference(s) compared to the displayed sequence where possible. Sometimes the term 'Several' is used to indicate that there are many differences.
  • Note is an optional free text explanation.

These lines will not be wrapped and their length may therefore exceed 75 characters.

3.12.9. Syntax of the topic 'WEB RESOURCE'
CC   -!- WEB RESOURCE: Name=ResourceName[; Note=FreeText][; URL=WWWAddress].

Where:

  • 'Name' is the name of the database;
  • 'Note' (optional) is a free text note;
  • 'URL' is the WWW address (URL) of the database;

The length of these lines may exceed 75 characters because long URL addresses are not wrapped into multiple lines.

3.13. The DR lineTable of contents

3.13.1. Definition

The DR (Database cross-Reference) lines are used as pointers to information related to entries and found in data collections other than Swiss-Prot. The full list of all databases to which the knowledgebase is cross-referenced can be found in the document file dbxref.txt. It also contains a list of references describing these databases and provides a link to the web sites.

For example, if the X-ray crystallographic atomic coordinates of a sequence are stored in the Protein Data Bank (PDB) there will be one DR line pointing to each of the corresponding entries in PDB. For a sequence translated from a nucleotide sequence there will be DR line(s) pointing to the relevant entri(es) in the EMBL/GenBank/DDBJ database which correspond to the DNA or RNA sequence(s) from which it was translated.

The format of the DR line is:

DR   DATABASE_IDENTIFIER; PRIMARY_IDENTIFIER; SECONDARY_IDENTIFIER[; TERTIARY_IDENTIFIER][; QUATERNARY_IDENTIFIER].

The cross-references to the EMBL/GenBank/DDBJ nucleotide sequence database and PROSITE are described in sections 3.23.7 and 3.23.117.

3.13.2. Database identifier

The first item on the DR line, the 'DATABASE_IDENTIFIER', is the abbreviated name of the data collection to which reference is made. The currently defined database identifiers are listed below.

Identifier Database description
EMBL Nucleotide sequence database of EMBL/EBI (see 3.23.7)
2DBase-Ecoli 2D-PAGE database of Escherichia coli
Aarhus/Ghent-2DPAGE Human keratinocyte 2D gel protein database from Aarhus and Ghent universities
ArrayExpress Public repository for microarray gene expression data
AGD Ashbya genome database
ANU-2DPAGE Australian National University 2-DE database
Bgee Bgee dataBase for Gene Expression Evolution
BindingDB The Binding Database
BioCyc Collection of Pathway/Genome Databases
BRENDA BRENDA Comprehensive Enzyme Information System
BuruList Mycobacterium ulcerans (strain Agy99) genome database
CAZy Carbohydrate-Active enZymes
CGD Candida genome database
CleanEx Public gene expression data via unique approved gene symbols
COMPLUYEAST-2DPAGE 2-D database at Universidad Complutense de Madrid
Cornea-2DPAGE 2D-PAGE database from the Aarhus university
CYGD The MIPS Comprehensive Yeast Genome Database
dictyBase Dictyostelium discoideum online informatics resource
DIP Database of interacting proteins
DOSAC-COBS-2DPAGE 2D-PAGE database from the dipartimento oncologico di III Livello
DisProt Database of protein disorders
DrugBank The DrugBank database (DrugBank)
EchoBASE The integrated post-genomic database for E. coli (EchoBASE)
ECO2DBASE Escherichia coli gene-protein database (2D gel spots) (ECO2DBASE)
EcoGene Escherichia coli K12 genome database (EcoGene)
Ensembl Database of automatically annotated sequences of large genomes (Ensembl database)
euHCVdb The European Hepatitis C Virus database
FlyBase Drosophila genome database (FlyBase)
Gene3D Database of structural assignments for genes (Gene3D)
GeneCards GeneCards: human genes, protein and diseases
GeneDB_Spombe Schizosaccharomyces pombe GeneDB
GeneFarm Structural and functional annotation of Arabidopsis thaliana gene and protein families (GeneFarm)
GeneID Database of genes from NCBI RefSeq genomes
GenomeReviews Genome reviews database
GermOnline GermOnline database
GlycoSuiteDB Database of glycan structures (GlycoSuiteDB)
GO Gene Ontology (GO) database
Gramene Comparative mapping resource for grains (Gramene)
HGNC Human gene nomenclature database (HGNC)
H-InvDB Human gene database H-Invitational Database (H-InvDB)
HAMAP Database of microbial protein families (HAMAP)
HOGENOM Homologous genes from fully sequenced organisms database
HOVERGEN Homologous vertebrate genes database
HPA Human Protein Atlas
HSC-2DPAGE Harefield hospital 2D gel protein databases (HSC-2DPAGE)
HSSP Homology-derived secondary structure of proteins database (HSSP)
IntAct Protein interaction database and analysis system (IntAct)
InterPro Integrated resource of protein families, domains and functional sites (InterPro)
IPI International Protein Index
KEGG Kyoto encyclopedia of genes and genomes
LegioList Legionella pneumophila (strains Paris and Lens) genome database
Leproma Mycobacterium leprae genome database (Leproma)
ListiList Listeria innocua and Listeria monocytogenes genomes database
MaizeGDB Maize Genetics/Genomics Database (MaizeGDB)
MEROPS Peptidase database (MEROPS)
MGI Mouse Genome Informatics Database (MGI)
MIM Mendelian Inheritance in Man Database (MIM)
MypuList Mycoplasma pulmonis genome database (MypuList)
NextBio NextBio
NMPDR National Microbial Pathogen Data Resource
OGP Oxford GlycoProteomics 2-DE database (OGP)
OMA Identification of Orthologs from Complete Genome Data
Orphanet Orphanet; a database dedicated to information on rare diseases and orphan drugs
PANTHER Protein ANalysis THrough Evolutionary Relationships (PANTHER) Classification System
PDB 3D-macromolecular structure Protein Data Bank (PDB)
PDBsum PDB sum
PeptideAtlas PeptideAtlas
PeroxiBase Peroxidase superfamilies database
Pfam Pfam protein domain database
PharmGKB The Pharmacogenetics and Pharmacogenomics Knowledge Base
PHCI-2DPAGE Parasite host cell interaction 2D-PAGE database
Pathway_Interaction_DB NCI-Nature Pathway Interaction Database
PhosphoSite Phosphorylation site database
PhosSite Phosphorylation Site Database for prokaryotic proteins
PhotoList Photorhabdus luminescens genome database
PIR Protein sequence database of the Protein Information Resource (PIR)
PIRSF Protein classification system of PIR (PIRSF)
PMAP-CutDB CutDB - Proteolytic event database
PMMA-2DPAGE Purkyne Military Medical Academy 2D-PAGE database
PptaseDB Prokaryotic protein phosphatase database
PRIDE PRoteomics IDEntifications database
PRINTS Protein Fingerprint database (PRINTS)
ProDom ProDom protein domain database
ProMEX Protein Mass spectra EXtraction database
PROSITE PROSITE protein domain and family database (see 3.23.117)
PseudoCAP Pseudomonas aeruginosa Community Annotation Project
Rat-heart-2DPAGE Two-dimensional polyacrylamide gel electrophoresis database of rat heart
Reactome Curated resource of core pathways and reactions in human biology (Reactome)
REBASE Restriction enzymes and methylases database (REBASE)
RefSeq NCBI reference sequences
REPRODUCTION-2DPAGE 2D-PAGE database from the Lab of Reproductive Medicine at the Nanjing Medical University
RGD Rat Genome Database (RGD)
SagaList Streptococcus agalactiae NEM316 / Serotype III genome database
SGD Saccharomyces Genome Database (SGD)
Siena-2DPAGE 2D-PAGE database from the Department of Molecular Biology, University of Siena, Italy
SMART Simple Modular Architecture Research Tool (SMART)
SMR The SWISS-MODEL Repository (SMR)
SubtiList Bacillus subtilis 168 genome database (SubtiList)
SWISS-2DPAGE 2D-PAGE database from the Geneva University Hospital (SWISS-2DPAGE)
TAIR The Arabidopsis Information Resource (TAIR)
TCDB Transport Classification Database
TIGR The bacterial databases of 'The Institute of Genome Research' (TIGR)
TIGRFAMs TIGR protein family database (TIGRFAMs)
TubercuList Mycobacterium tuberculosis H37Rv genome database (TubercuList)
UniGene UniGene database
VectorBase Bioinformatics resource for invertebrate vectors of human pathogens
World-2DPAGE The World-2DPAGE database
WormBase A multi-species resource for nematode biology and genomics (WormBase)
WormPep Caenorhabditis elegans genome sequencing project protein database (WormPep)
Xenbase Xenopus laevis and tropicalis biology and genome database
ZFIN Zebrafish Information Network genome database (ZFIN)
3.13.3. The primary identifier

The second item on the DR line, the 'PRIMARY_IDENTIFIER', is an unambiguous pointer to the information entry in the database to which the reference is being made.

  • For a BioCyc, CGD, CleanEx, DIP, DisProt, DrugBank, EchoBASE, EcoGene, FlyBase, Gene3D, GeneCards, GeneID, GeneFarm, GenomeReviews, GO, HPA, InterPro, IPI, KEGG, MEROPS, MGI, MIM, NextBio, NMPDR, Orphanet, PANTHER, Pfam, PharmGKB, PIR, PptaseDB, PRINTS, ProDom, Rat-heart-2DPAGE, Reactome, REBASE, RefSeq, REPRODUCTION-2DPAGE, RGD, SGD, SMART, SubtiList, TCDB , TIGRFAMs, UniGene, World-2DPAGE, Xenbase or ZFIN reference the primary identifier is the first accession number (also called the Unique Identifier in some databases) of the entry to which reference is being made.
  • For a 2DBase-Ecoli, ANU-2DPAGE, ArrayExpress, Bgee, BindingDB, COMPLUYEAST-2DPAGE, Cornea-2DPAGE, DOSAC-COBS-2DPAGE, GlycoSuiteDB, Gramene, HOGENOM, HOVERGEN, HSC-2DPAGE, IntAct, OGP, OMA, PHCI-2DPAGE, PhosphoSite, PMAP-CutDB, PMMA-2DPAGE, PeptideAtlas, PhosSite, PRIDE, ProMEX, Siena-2DPAGE, SMR or SWISS-2DPAGE reference the primary identifier is the UniProtKB accession number.
  • For a AGD, BuruList, CYGD, dictyBase, Ensembl, GeneDB_Spombe, GermOnline, ListiList, Peroxibase, PhotoList, PseudoCAP, SagaList, TAIR, VectorBase or WormBase reference the primary identifier is the unique identifier for a gene.
  • For a BRENDA reference the primary identifier is an EC number.
  • For a CAZy reference the primary identifier is the CAZy family number.
  • For a HGNC reference the primary identifier is the unique identifier assigned by the HUGO Gene Nomenclature Committee.
  • For a H-InvDB reference the primary identifier is the unique identifier of a cDNA cluster.
  • For a HAMAP reference the primary identifier is the unique identifier of a HAMAP protein family.
  • For a Pathway_Interaction_DB reference the primary identifier is the 'short pathway name'.
  • For a PDB reference the primary identifier is the entry name.
  • For a PDBsum reference the primary identifier is the PDB entry name.
  • For a PIRSF reference the primary identifier is the protein family number.
  • For an AARHUS/GHENT-2DPAGE or ECO2DBASE reference the primary identifier is the alphanumeric designation of the protein spot.
  • For a WormPep reference the primary identifier is the cosmid-derived name given to the protein by the C.elegans genome sequencing project.
  • For a MaizeGDB reference the primary identifier is the 'Gene-product' accession ID.
  • For a LegioList, Leproma, MypuList, TIGR or TubercuList reference the primary identifier is the genome Open Reading Frame (ORF) code.
  • For an HSSP reference the primary identifier is the accession number of a UniProtKB entry cross-referenced to a PDB entry whose structure is expected to be similar to that of the entry in which the HSSP cross-reference is present.
  • For a euHCVdb reference the primary identifier is the an EMBL accession number.
3.13.4. The secondary identifier

The third item on the DR line, the 'SECONDARY_IDENTIFIER', is generally used to complement the information given by the first identifier.

  • For a Gene3D, InterPro, PANTHER, Pfam, PIR, PRINTS, ProDom, REBASE, SMART or TIGRFAMs reference the secondary identifier is the entry name.
  • For a PDB reference the secondary identifier is the structure determination method, which is controlled vocabulary that currently includes: X-ray (for X-ray crystallography), NMR (for NMR spectroscopy), EM (for electron microscopy and cryo-electron diffraction), Fiber (for fiber diffraction), IR (for infrared spectroscopy), Model (for predicted models) and Neutron (for neutron diffraction).
  • For a dictyBase, EcoGene, FlyBase, CGD, HGNC, MGI, RGD, SGD, SubtiList, WormBase, Xenbase or ZFIN reference the secondary identifier is the gene designation. If the gene designation is not available, a dash ('-') is used.
  • For a GO reference, the second identifier is a 1-letter abbreviation for one of the 3 ontology aspects, separated from the GO term by a column. If the term is longer than 46 characters, the first 43 characters are indicated followed by 3 dots ('...'). The abbreviations for the 3 distinct aspects of the ontology are P (biological Process), F (molecular Function), and C (cellular Component).
  • For a HAMAP reference the secondary identifier indicates if a domain is 'atypical' and/or 'fused', otherwise the field is empty ('-').
  • For an ECO2DBASE reference the secondary identifier is the latest release number or edition of the database that has been used to derive the cross-reference.
  • For a Ensembl or VectorBase reference the secondary identifier is the species of origin.
  • For a PIRSF reference the secondary identifier is the protein family name.
  • For an AARHUS/GHENT-2DPAGE reference the secondary identifier is either 'IEF' (for isoelectric focusing) or 'NEPHGE' (for non-equilibrium pH gradient electrophoresis).
  • For a WormPep reference the secondary identifier is a number attributed by the C.elegans genome-sequencing project to that protein.
  • For a 2DBase-Ecoli, AGD, ANU-2DPAGE, ArrayExpress, Bgee, BindingDB, BioCyc, CleanEx, COMPLUYEAST-2DPAGE, Cornea-2DPAGE, CYGD, DIP, DisProt, DOSAC-COBS-2DPAGE, EchoBASE, GeneDB_Spombe, GeneCards, GeneID, GlycoSuiteDB, Gramene, HOGENOM, HOVERGEN, HSC-2DPAGE, H-InvDB, HPA, IPI, KEGG, LegioList, Leproma, ListiList, MaizeGDB, MEROPS, MypuList, NextBio, NMPDR, OGP, PDBsum, PeptideAtlas, PharmGKB, PHCI-2DPAGE, PhosphoSite, PhosSite, PhotoList, PMAP-CutDB, PMMA-2DPAGE, PRIDE, ProMEX, PptaseDB, PseudoCAP, Rat-heart-2DPAGE, RefSeq, REPRODUCTION-2DPAGE, SagaList, Siena-2DPAGE, SWISS-2DPAGE, TAIR, TIGR, TubercuList, UniGene or World-2DPAGE reference the secondary identifier is not used and a dash ('-') is stored in that field.
  • For an HSSP reference the secondary identifier is the entry name of the PDB structure related to that of the entry in which the HSSP cross-reference is present.
  • For a GeneFarm reference the secondary identifier is the gene family identifier. If the gene family identifier is not available, a dash ('-') is used.
  • For a IntAct reference the secondary identifier indicates the number of interactors.
  • For a SMR reference the secondary identifier indicates the range(s) relevant to the structure model(s).
  • For a MIM reference the secondary identifier distinguishes between MIM "gene" and "phenotype" entries. Note that some MIM entries describe both a gene and a phenotype. In such a case, the secondary identifier indicates "gene+phenotype".
  • For a CAZy reference the secondary identifier is the CAZy family name.
  • For a Orphanet reference the secondary identifier is the name of the disease caused by defects in the protein.
  • For a GenomeReviews reference the secondary identifier is the OrderedLocusNames (OLN), or, if it doesn't exist, the ORFNames or the gene name.
  • For a GermOnline reference the secondary identifier is the organism name.
  • For a PeroxiBase reference the secondary identifier is a name given by the database curators, based on organism and peroxidase classification.
  • For a Reactome reference the secondary identifier is the name of the pathway.
  • For a BRENDA reference the secondary identifier is an organism code from BRENDA.
  • For a DrugBank reference the secondary identifier is a drug generic name for which the protein is a target.
  • For a OMA reference the secondary identifier is the OMA group fingerprint.
  • For a Pathway_Interaction_DB reference the secondary identifier is the 'full pathway name'. Note that the 'short' can actually be longer than the 'full' name.
  • For a TCDB reference the secondary identifier is the transport classification family name.
3.13.5. The tertiary identifier

A number of DR lines possess a fourth item, the 'TERTIARY_IDENTIFIER', which is generally used to give more detailed information.

  • For the protein domain/family or structural databases Gene3D, HAMAP, PANTHER, Pfam, PIRSF, ProDom, SMART and TIGRFAMs the tertiary identifier is the number of hits found in the sequence.
  • For GO the tertiary identifier is a 3-character GO evidence code. The GO evidence code is followed by the source database from which the cross-reference was obtained, separated by a colon. The definitions of the evidence codes are: IDA=inferred from direct assay, IMP=inferred from mutant phenotype, IGI=inferred from genetic interaction, IPI=inferred from physical interaction, IEP=inferred from expression pattern, TAS=traceable author statement, NAS=non-traceable author statement, IC=inferred by curator, ISS=inferred from sequence or structural similarity.
  • For PDB, the tertiary identifier indicates the resolution of structures that were determined by X-ray crystallography or electron microscopy.
3.13.5.1. The quaternary identifier

A number of DR lines possess a fifth item, the 'QUATERNARY_IDENTIFIER', which is generally used to give more detailed information.

  • For PDB, the quaternary identifier indicates the chain(s) and the corresponding range, of which the structure has been determined. If the range is unknown, a dash is given rather than the range positions (e.g. 'A/B=-.'), if the chains and the range is unknown, a dash is used.

Examples of complete DR lines are shown here:

DR   EMBL; U29082; AAA68403.1; -; Genomic_DNA.
DR   2DBase-Ecoli; P02930; -.
DR   Aarhus/Ghent-2DPAGE; 8006; IEF.
DR   AGD; AAR059C; -.
DR   ANU-2DPAGE; Q9XEA8; -.
DR   ArrayExpress; O00139; -.
DR   Bgee; Q2TV78; -.
DR   BindingDB; P06709; -.
DR   BioCyc; EcoCyc:USHA-MONOMER; -.
DR   BRENDA; 3.5.99.5; 3804.
DR   BuruList; MUL_4631; -.
DR   CAZy; GH109; Glycoside Hydrolase Family 109.
DR   CGD; CAL0001939; orf19.773.
DR   CleanEx; MM_KIFC2; -.
DR   COMPLUYEAST-2DPAGE; P41797; -.
DR   Cornea-2DPAGE; P31946; -.
DR   CYGD; YOL002c; -.
DR   dictyBase; DDB0191351; myoB.
DR   DIP; DIP:37N; -.
DR   DisProt; DP00239; -.
DR   DOSAC-COBS-2DPAGE; P02774; -.
DR   DrugBank; APRD00096; Tegaserod.         
DR   EchoBASE; EB4119; -.
DR   ECO2DBASE; G052.0; 6TH EDITION.
DR   EcoGene; EG10054; araC.
DR   Ensembl; ENSG00000012174; Homo sapiens.
DR   euHCVdb; AF271632; -.
DR   FlyBase; FBgn0000055; Adh.
DR   Gene3D; G3DSA:2.40.128.50; D_amino_pept_C; 2.
DR   GeneCards; GC16M001213; -.
DR   GeneDB_Spombe; SPAC8E11.02c; -.
DR   GeneFarm; 1671; 91.
DR   GeneID; 36674; -.
DR   GenomeReviews; U00096_GR; b0016.
DR   GermOnline; AT1G64970; Arabidopsis thaliana.
DR   GlycoSuiteDB; P05067; -.
DR   GO; GO:0003677; F:DNA binding; IPI:SGD.
DR   Gramene; Q06967; -.
DR   HGNC; HGNC:12849; YWHAB.
DR   H-InvDB; HIX0004037; -.
DR   HAMAP; MF_00120; -; 1.
DR   HOGENOM; Q811W1; -.
DR   HOVERGEN; Q0VD83; -.
DR   HPA; CAB004311; -.
DR   HSC-2DPAGE; P47985; -.
DR   HSSP; P00438; 1PBE.
DR   IntAct; P14653; 1.
DR   InterPro; IPR001650; Helicase_C.
DR   IPI; IPI00000005; -.
DR   KEGG; bsu:BG10490; -.
DR   LegioList; lpp2301; -.
DR   Leproma; ML0485; -.
DR   ListiList; LIN01355; -.
DR   MaizeGDB; 25342; -.
DR   MEROPS; M41.009; -.
DR   MGI; MGI:87920; Adfp.
DR   MIM; 140050; gene.
DR   MypuList; MYPU_4900; -.
DR   NextBio; 12125; -.
DR   NMPDR; fig|4932.3.peg.4857; -.
DR   OGP; P31946; -.
DR   OMA; Q8BM88; PLRFDWR.
DR   Orphanet; 64; Alstrom syndrome.
DR   PANTHER; PTHR12103; HAD-IG-Ncltidse; 1.
DR   Pathway_Interaction_DB; a6b1_a6b4_integrin_pathway; a6b1 and a6b4 Integrin signaling.
DR   PDB; 1NB3; X-ray; 2.80 A; A/B/C/D=116-335, P/R/S/T=98-105.
DR   PDBsum; 1HF1; -.
DR   PeptideAtlas; P32494; -.
DR   PeroxiBase; 79; AtPrx03.
DR   Pfam; PF00017; SH2; 1.
DR   PharmGKB; PA134908332; -.
DR   PHCI-2DPAGE; Q9Z8U5; -.
DR   PhosphoSite; P01266; -.
DR   PhosSite; Q9Z3H2; -.
DR   PhotoList; plu0872; -.
DR   PIR; A00682; KIPGA.
DR   PIRSF; PIRSF006414; Ftr_formyl_trnsf; 1.
DR   PMAP-CutDB; P38398; -.
DR   PMMA-2DPAGE; P04179; -.
DR   PptaseDB; P3D040495; -.
DR   PRIDE; P10144; -.
DR   PRINTS; PR00237; GPCRRHODOPSN.
DR   ProDom; PD000511; Aconitase_N; 1.
DR   ProMEX; P49200; -.
DR   PROSITE; PS00107; PROTEIN_KINASE_ATP; 2.
DR   PseudoCAP; PA0892; -.
DR   Rat-heart-2DPAGE; P62738; -.
DR   Reactome; REACT_1675.1; mRNA Processing.
DR   REBASE; 993; EcoRI.
DR   RefSeq; NP_611010.3; -.
DR   REPRODUCTION-2DPAGE; IPI00022774; -.
DR   RGD; 70968; Ddah1.
DR   SagaList; gbs1023; -.
DR   SGD; S000000170; AAR2.
DR   Siena-2DPAGE; P38008; -.
DR   SMART; SM00369; LRR_TYP; 2.
DR   SMR; P38479; 3-141, 560-617.
DR   SubtiList; BG10774; oppD.
DR   SWISS-2DPAGE; P10599; -.
DR   TAIR; At4g02980; -.
DR   TCDB; 1.A.1.11.11; voltage-gated ion channel (VIC) superfamily.
DR   TIGR; MJ0125; -.
DR   TIGRFAMs; TIGR00630; uvra; 1.
DR   TubercuList; Rv0001; -.
DR   UniGene; Hs.505267; -.
DR   VectorBase; AGAP000553; Anopheles gambiae.
DR   World-2DPAGE; 0001:P77845; -.
DR   WormBase; WBGene00006744; unc-4.
DR   WormPep; ZK637.7a; CE28194.
DR   Xenbase; XB-FEAT-481105; hdac3.
DR   ZFIN; ZDB-GENE-980526-290; hoxb1b.
3.13.6. Cross-references to the nucleotide sequence database

The specific format for cross-references to the EMBL/GenBank/DDBJ nucleotide sequence database is:

DR   EMBL; ACCESSION_NUMBER; PROTEIN_ID; STATUS_IDENTIFIER; MOLECULE_TYPE.

where 'PROTEIN_ID' stands for the 'Protein Sequence Identifier'. It is a string which is stored, in nucleotide sequence entries, in a qualifier called '/protein_id' which is tagged to every CDS in the nucleotide database. Example from EMBL:

FT   CDS 302..2674
FT   /protein_id="CAA03857.1"
FT   /db_xref="SWISS-PROT:P26345"
FT   /gene="recA"
FT   /product="RecA protein"

The Protein Sequence Identifier (Protein_ID) consists of a stable ID portion (8 characters: 3 letters followed by 5 numbers) plus a period and a version number. The version number only changes when the protein sequence coded by the CDS changes, while the stable part remains unchanged. The Protein_ID effectively replaces what was previously known as the 'PID'.

The 'STATUS_IDENTIFIER' provides information about the relationship between the sequence in the entry and the CDS in the corresponding EMBL entry:

a) In most cases the translation of the EMBL nucleotide sequence CDS results in the same sequence as shown in the corresponding entry or the differences are mentioned in the feature (FT) lines as CONFLICT, VARIANT or VAR_SEQ and in the RP lines. The status identifier is then a dash ('-').

Example:

DR   EMBL; AJ297977; CAC17465.1; -; Genomic_DNA.
DR   EMBL; X56491; CAA39846.1; ALT_FRAME; mRNA.

b) In some cases the translation of the EMBL nucleotide sequence CDS results in a sequence different from the sequence shown in the corresponding entry. When the differences are either not mentioned in the feature (FT) lines as CONFLICT, VARIANT or VAR_SEQ (see this section) and in the RP lines, or do simply not meet the criteria for such situations, the differences are indicated as follows:

1. If the difference is due to a different start of the sequence (i.e. Swiss-Prot believes that the start of the sequence is upstream or downstream of the site annotated as the start of the sequence in the EMBL database), the status identifier shows the comment 'ALT_INIT'. Example:

DR   EMBL; L29151; AAA99430.1; ALT_INIT; mRNA.
2. If the difference is due to a different termination of the sequence (i.e. Swiss-Prot believes that the termination of the sequence is upstream or downstream of the site annotated as the end of the sequence in the EMBL database), the status identifier shows the comment 'ALT_TERM'. Example:

DR   EMBL; L20562; AAA26884.1; ALT_TERM; Genomic_DNA.
3. If the difference is due to frameshifts in the EMBL sequence, the status identifier shows the comment 'ALT_FRAME'. Example:
DR   EMBL; X56420; CAA39814.1; ALT_FRAME; mRNA.
4. If the difference is not due to any of the cases mentioned above (e.g. wrong intron-exon boundaries given in the EMBL entry) or to a mixture of the cases mentioned above, the status identifier shows the comment 'ALT_SEQ'. Example:
DR   EMBL; M28482; AAA26378.1; ALT_SEQ; Genomic_DNA.

c) In some cases the nucleotide sequence of a complete CDS is divided into exons present in different EMBL entries. We point to the exon-containing EMBL entries by citing the Protein_ID as secondary identifier and adding the comment 'JOINED' as the status identifier. These EMBL entries do not contain a CDS feature but contain exons joined to a CDS feature which is labeled with the given Protein_ID.

Example:

DR   EMBL; M63397; AAA51662.1; -; Genomic_DNA.
DR   EMBL; M63395; AAA51662.1; JOINED; Genomic_DNA.
DR   EMBL; M63396; AAA51662.1; JOINED; Genomic_DNA.

In the above example the Swiss-Prot sequence is derived from the CDS labeled with the Protein_ID AAA51662. This CDS feature can be found in the EMBL entry M63397. Exons belonging to this CDS are not only found in EMBL entry M63397, but also in the EMBL entries M63395 and M63396.

d) In some cases there is no CDS feature key annotating a protein translation in an EMBL entry and thus no Protein_ID for the CDS. Therefore it is not possible for us to point to a Protein_ID as a secondary identifier. In these cases we point to the relevant EMBL entries by including a dash ('-') in the position of the missing Protein_ID and 'NOT_ANNOTATED_CDS' into the status identifier.

Example:

DR   EMBL; AJ243418; -; NOT_ANNOTATED_CDS; mRNA.

The 'MOLECULE_TYPE' provides information about the biological source of the molecule. The molecule type is controlled vocabulary, which corresponds to that of The International Nucleotide Sequence Database Collaboration (INSD) comprised of DDBJ (Japan), the EMBL-Bank(UK) and GenBank (USA). Relevant to the UniProt Knowledgebase are the following values:

  • Genomic_DNA: any genomic DNA; includes nuclear, organelle, plasmid ...
  • Genomic_RNA: genomic RNA
  • Transcribed_RNA: any transcribed RNA that is not mRNA; includes unmature RNA (pre-RNA)
  • mRNA: mRNA; includes cDNA
  • Viral_cRNA: positive cRNA molecule from a single stranded genomic RNA
  • Unassigned_DNA: unknown in vivo DNA
  • Unassigned_RNA: unknown in vivo RNA
  • Other_DNA: synthetic DNA
  • Other_RNA: synthetic RNA
  • -: unknown
3.13.7. Cross-references to the PROSITE database

The specific format for cross-references to the PROSITE protein domain and family database is:

DR   PROSITE; ACCESSION_NUMBER; ENTRY_NAME; STATUS.

Where 'ACCESSION_NUMBER' stands for the accession number of the PROSITE pattern or profile entry; 'ENTRY_NAME' is the name of the entry and 'STATUS' is one of the following:

n
FALSE_NEG
PARTIAL
UNKNOWN_n

Where 'n' is the number of hits of the pattern or profile in that particular protein sequence. The 'FALSE_NEG' status indicates that while the pattern or profile did not detect the protein sequence, it is a member of that particular family or domain. The 'PARTIAL' status indicates that the pattern or profile did not detect the sequence because the sequence is not complete and lacks the region on which the pattern/profile is based. Finally the 'UNKNOWN' status indicates uncertainties as to the fact that the sequence is a member of the family or contains the domain described by the pattern/profile.

Examples of PROSITE cross-references:

DR   PROSITE; PS00107; PROTEIN_KINASE_ATP; 2.
DR   PROSITE; PS00028; ZINC_FINGER_C2H2_1; 4.
DR   PROSITE; PS00237; G_PROTEIN_RECEP_F1_1; FALSE_NEG.
DR   PROSITE; PS00603; TK_CELLULAR_TYPE; PARTIAL.
DR   PROSITE; PS50234; VWFA; UNKNOWN_1.
3.14. The PE lineTable of contents

The PE (Protein existence) line gives indication on the evidences that we currently have for the existence of a protein. Because most protein sequences are derived from translation of nucleotide sequences and are mere predictions, the PE line indicates what the evidences are of the existence of a protein.

Note that the 'PE' line does not give information on the accuracy or correctness of the sequence displayed. While it gives information on the existence of a protein, it may happen that the sequence slightly differ, especially for sequences derived from gene model predictions from genomic sequences.

The format of the PE line is:

PE   Level: Evidence;

With the following values:

  • 1: Evidence at protein level
  • 2: Evidence at transcript level
  • 3: Inferred from homology
  • 4: Predicted
  • 5: Uncertain

Example:

PE   1: Evidence at protein level;

The status 'Evidence at protein level' indicates that there is clear experimental evidence (such as a characterization paper, partial to complete Edman sequencing, clear identification by mass spectrometry (MSI), X-ray or NMR structure, detection by antibodies etc.) for the existence of this protein.

The status 'Evidence at transcript level' is used to indicate that the existence of a protein has not been strictly proved but that expression data (presence of cDNAs, RT-PCR, Northern blots) indicates the existence of a transcript.

The status 'Inferred from homology' is used to indicate that the existence of a protein is probable because clear orthologs exist in closely related species.

The status 'Predicted' is used for entries without evidence at protein, transcript, or homology levels.

The status 'Uncertain' indicates that the existence of the protein is unsure.

Criteria used to assign a PE level to entries are described in the document file pe_criteria.txt

3.15. The KW lineTable of contents

The KW (KeyWord) lines provide information that can be used to generate indexes of the sequence entries based on functional, structural, or other categories. The keywords chosen for each entry serve as a subject reference for the sequence. The document keywlist.txt lists all the keywords and a definition of their usage in the database. Often several KW lines are necessary for a single entry. The document keyindex.txt is an index of the corresponding sequence entries.

The format of the KW line is:

KW   Keyword[; Keyword...].

More than one keyword may be listed on each KW line; semicolons separate the keywords, and the last keyword is followed by a period. An entry often contains several KW lines. Keywords may consist of more than one word (they may contain blanks), but are never split between lines. The keywords are stored by alphabetical order. An example of KW lines in an entry is:

KW   3D-structure; Alternative splicing; Alzheimer disease; Amyloid;
KW   Apoptosis; Cell adhesion; Coated pits; Copper;
KW   Direct protein sequencing; Disease mutation; Endocytosis;
KW   Glycoprotein; Heparin-binding; Iron; Membrane; Metal-binding;
KW   Notch signaling pathway; Phosphorylation; Polymorphism;
KW   Protease inhibitor; Proteoglycan; Serine protease inhibitor; Signal;
KW   Transmembrane; Zinc.

TrEMBL makes use of the same controlled list of keywords as is used in Swiss-Prot but, as most keywords in an entry are added during the annotation process, TrEMBL entries generally contain fewer keywords than Swiss-Prot entries. The main sources of TrEMBL keywords are:

  • The underlying nucleotide entry. The nucleotide databases add keywords and any which are also found in the UniProtKB controlled list are added to the corresponding TrEMBL entry.
  • The program which creates TrEMBL entries. This adds keywords based on information in the underlying nucleotide entry. For example, if a nucleotide entry contains the word "kinase" in the description, the program adds the keyword "Kinase" to the corresponding TrEMBL entry.
  • Automatic annotation.
3.16. The FT lineTable of contents

The FT (Feature Table) lines provide a precise but simple means for the annotation of the sequence data. The table describes regions or sites of interest in the sequence. In general the feature table lists posttranslational modifications, binding sites, enzyme active sites, local secondary structure or other characteristics reported in the cited references. Sequence conflicts between references are also included in the feature table.

The FT lines have a fixed format. The column numbers allocated to each of the data items within each FT line are shown in the following table (column numbers not referred to in the table are always occupied by blanks).

Columns Data item
1-2 FT
6-13 Key name
15-20 'From' endpoint
22-27 'To' endpoint
35-75 Description

The key name and the endpoints are always on a single line, but the description may require one or more additional lines. In this event, the following line contains blanks in the columns 3-34, and the description continues from column 35 onwards as in the line above. Thus a blank key always denotes a continuation of the previous description.

An example of a feature table is shown below:

FT   NON_TER       1      1
FT   SIGNAL       <1     10       By similarity.
FT   CHAIN        19     87       A-agglutinin.
FT   PROPEP       22     43       Removed by a dipeptidylpeptidase.
FT   MOD_RES      41     41       Arginine amide (By similarity).
FT   DISULFID    110    115
FT   CARBOHYD    251    251       N-linked (GlcNAc...).
FT   CONFLICT    327    327       E -> R (in Ref. 2).
FT   CONFLICT     77     77       Missing (in Ref. 1).

The first item on each FT line is the key name, which is a fixed abbreviation (of up to 8 characters) with a defined meaning. A list of the currently defined key names can be found in this section of this document.

Following the key name are the 'FROM' and 'TO' endpoint specifications. These fields designate (inclusively) the endpoints of the feature named in the key field. In general, these fields simply contain residue numbers which indicate positions in the sequence as listed. Note that these positions are always specified assuming a numbering of the listed sequence from 1 to n; this numbering is not necessarily the same as that used in the original reference(s). The following should be noted:

  • If the 'FROM' and 'TO' specifications are identical, the feature involves one single amino acid;
  • When a feature is known to extend beyond the position that is given in the feature table, the endpoint specification will be preceded by '<' for features which continue to the left end (N-terminal direction) or by '>' for features which continue to the right end (C- terminal direction);
  • Unknown endpoints are denoted by '?'. Uncertain endpoints are denoted by a '?' before the position, e.g. '?42'.

See also the notes concerning each of the key names in this section

The remaining portion of the FT line is a description that contains additional information about the feature. For example, for a posttranslationally modified residue (key MOD_RES) the chemical nature of the modified residue is given, while for a sequence variation (key VARIANT) the nature of the variation is indicated. This portion of the line is generally in free form, and may be continued on additional lines when necessary.

3.16.1. Feature identifiers

Some features are associated with a unique and stable feature identifier (FTId), which allows to construct links directly from position-specific annotation in the feature table to specialized protein-related databases. The FTId is always the last component of a feature in the description field. The format of a feature with a feature identifier is:

FT   KEY_NAME     x      x        [Description.]
FT				  /FTId=XXX_number.

where XXX is the 3-letter code for the specific feature key, separated by an understore from a 6 to 10-digit number.

Feature identifiers currently exist for the feature keys CARBOHYD, CHAIN, PEPTIDE, PROPEP, VARIANT and VAR_SEQ . The format of the corresponding FTIds is shown in the following table:

Key name Format of the FTId Availability
CARBOHYD CAR_number Currently only for residues attached to an oligosaccharide structure annotated in the GlycoSuiteDB database
CHAIN, PEPTIDE PRO_number Any mature polypeptide
PROPEP PRO_number Any processed propeptide
VARIANT VAR_number Currently only for protein sequence variants of Hominidae (great apes and humans)
VAR_SEQ VSP_number Any sequence with a VAR_SEQ feature

Examples of features with FTIds are given below:

FT   CARBOHYD    251    251       N-linked (GlcNAc...).
FT                                /FTId=CAR_000070.
 
FT   CHAIN        23    611       Halfway protein.
FT                                /FTId=PRO_0000021413.
FT   PEPTIDE      20     57       Histatin 1.
FT                                /FTId=PRO_0000021416.
 
FT   PROPEP       25     48
FT                                /FTId=PRO_0000021449.
FT   VARIANT     214    214       V -> I.
FT                                /FTId=VAR_009122.
FT   VAR_SEQ      33     83       TPDINPAWYTGRGIRPVGRFGRRRATPRDVTGLGQLSCLPL
FT                                DGRTKFSQRG -> SECLTYGKQPLTSFHPFTSQMPP (in
FT                                isoform 2).
FT                                /FTId=VSP_004370.

INIT_MET - Initiator methionine.

This feature key is associated with a '1' value in the 'FROM' and 'TO' fields to indicate that the initiator methionine has been cleaved off:

FT   INIT_MET      1      1       Removed.

It is not used when the initiator methionine is not cleaved off

SIGNAL - Extent of a signal sequence (prepeptide).

FT   SIGNAL        1     26
FT   SIGNAL        1     23       Potential.

PROPEP - Extent of a propeptide.

Examples of PROPEP key feature lines:

FT   PROPEP       27     28       Activation peptide.
FT   PROPEP      550    574       Removed in mature form.

TRANSIT - Extent of a transit peptide (mitochondrion, chloroplast, thylakoid, cyanelle, peroxisome etc.).

Examples of TRANSIT key feature lines:

FT   TRANSIT       1     42       Chloroplast.
FT   TRANSIT       1     65       Cyanelle.
FT   TRANSIT       1     25       Mitochondrion (By similarity).
FT   TRANSIT       1     34       Peroxisome (Potential).
FT   TRANSIT       ?     77       Thylakoid (By similarity).

CHAIN - Extent of a polypeptide chain in the mature protein.

  • In Swiss-Prot, it is present:
    1. For proteins that are not processed (those for which the mature protein sequence corresponds to the translated cDNA sequence) the CHAIN covers the whole protein sequence:
      	FT   CHAIN         1    333      COP9 signalosome complex subunit 5.
      	
    2. For processed proteins, it describes the mature part of the protein once preprotein parts such as propeptides and signal sequences have been removed:
      	FT   CHAIN        21    119       Beta-2-microglobulin.
      	
      	FT   CHAIN        41    180       Factor X light chain.
      	
  • For TrEMBL, it is present only in those entries where the submitters to the nucleotide sequence databases have provided this information for processed proteins.

PEPTIDE - Extent of a released active peptide.

Examples of PEPTIDE key feature lines:

FT   PEPTIDE       1      9       Arg-vasopressin.
FT   PEPTIDE     235    239       Met-enkephalin.

TOPO_DOM - Topological domain.

Examples:

FT   TOPO_DOM    337    371       Cytoplasmic.
FT   TOPO_DOM      1    471       Mitochondrial matrix (Potential).

TRANSMEM - Extent of a transmembrane region.

FT   TRANSMEM    202    222       Potential.
FT   TRANSMEM     67     87       Potential.

DOMAIN - Extent of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.

The domain type is given in the description field. If there exist several copies of a domain, the domains are numbered. Examples of DOMAIN key feature lines:

FT   DOMAIN       27    128       Cadherin 1.
FT   DOMAIN      745    939       Ras-GAP.
FT   DOMAIN      746    805       SH3.

REPEAT - Extent of an internal sequence repetition.

Examples of REPEAT key feature lines:

FT   REPEAT      225    307       1.
FT   REPEAT      341    423       2.
FT   REPEAT      455    537       3; approximate.

CA_BIND - Extent of a calcium-binding region.

Example:

FT   CA_BIND      20     31       1.

ZN_FING - Extent of a zinc finger region.

The zinc finger 'category' is indicated in the description field. Examples of ZN_FING key feature lines:

FT   ZN_FING     803    827       GATA-type.
FT   ZN_FING     559    579       NR C4-type.

DNA_BIND - Extent of a DNA-binding region.

The nature of the DNA-binding region is given in the description field. Examples of DNA_BIND key feature lines:

FT   DNA_BIND    335    415       ETS.
FT   DNA_BIND     69    128       Homeobox.
FT   DNA_BIND     16     67       Myb 2.
FT   DNA_BIND    135    200       TEA.

NP_BIND - Extent of a nucleotide phosphate-binding region.

The nature of the nucleotide phosphate is indicated in the description field. Examples of NP_BIND key feature lines:

FT   NP_BIND     182    189       ATP.
FT   NP_BIND      38     45       GTP (Potential).
FT   NP_BIND      35     42       FAD.

REGION - Extent of a region of interest in the sequence.

Examples:

FT   REGION      620    631       Zymogen activation region.
FT   REGION       52     84       Hydrophobic.

COILED - Extent of a coiled-coil region.

Example:

FT   COILED      258    553       Potential.

MOTIF - Short (up to 20 amino acids) sequence motif of biological interest.

Examples:

FT   MOTIF        94    101       Nuclear localization signal.
FT   MOTIF       648    650       Microbody targeting signal (Potential).

COMPBIAS - Extent of a compositionally biased region.

Examples:

FT   COMPBIAS    219    222       Poly-Ser.
FT   COMPBIAS     22    124       Glu-rich (acidic).

ACT_SITE - Amino acid(s) involved in the activity of an enzyme.

Examples of ACT_SITE key feature lines:

FT   ACT_SITE    238    238       Proton acceptor.
FT   ACT_SITE   1082   1082       Serine protease NS3; charge relay system
FT                                (By similarity).

METAL - Binding site for a metal ion.

The description field indicates the nature of the metal. Examples of METAL key feature lines:

FT   METAL        52     52       Iron (heme axial ligand).
FT   METAL        28     28       Copper (Potential).

BINDING - Binding site for any chemical group (co-enzyme, prosthetic group, etc.).

The chemical nature of the group is given in the description field. Examples of BINDING key feature lines:

FT   BINDING      14     14       Heme (covalent).
FT   BINDING     132    132       Chloride.

SITE - Any interesting single amino-acid site on the sequence, that is not defined by another feature key. It can also apply to an amino acid bond which is represented by the positions of the two flanking amino acids.

Example:

FT   SITE        391    392       Cleavage; by thrombin.

NON_STD - Non-standard amino acid

This key describes the occurrence of non-standard amino acids selenocysteine and pyrrolysine. Note that we also display them in the sequence data section and use the IUPAC/IUBMB recommended one-letter codes 'U' for selenocysteine and 'O' for pyrrolysine

FT   NON_STD      52     52       Selenocysteine.
FT   NON_STD     356    356       Pyrrolysine (By similarity).

MOD_RES - Posttranslational modification of a residue.

The chemical nature of the modified residue is given in the description. The general format of the MOD_RES description field is:

FT   MOD_RES     xxx    xxx       Name of the modified amino acid (comment).

The nature of the posttranslationally formed amino acid is annotated by using a controlled vocabulary; the currently defined list of controlled vocabulary, as well as other information such as the target amino acid, the related keyword, the species where the modification is annotated and the location of the mature protein are available in ptmlist.txt document. Links to example proteins and to the RESID database are also provided to help gain a better insight into every modification.

Modification Description
ACETYLATION N-terminal of some residues and side chain of lysine
AMIDATION Generally at the C-terminal of a mature active peptide after oxidative cleavage of last glycine
BLOCKED Unidentified N- or C-terminal blocking group
FORMYLATION Generally of the N-terminal methionine
GAMMA-CARBOXYGLUTAMIC ACID Of glutamate
HYDROXYLATION Generally of asparagine, aspartate, proline or lysine
METHYLATION Generally of N-terminal phenylalanine, side chain of lysine, arginine, histidine, asparagine or glutamate, and C-terminal cysteine
PHOSPHORYLATION Of serine, threonine, tyrosine, aspartate, histidine or cysteine, and, more rarely, of arginine
PYRROLIDONE CARBOXYLIC ACID N-terminal glutamine which has formed an internal cyclic lactam. This is also called 'pyro-Glu'. Very rarely, pyro-Glu can be produced by modification of a N-terminal glutamate
SULFATION Of tyrosine, serine or threonine

Examples of MOD_RES key feature lines:

FT   MOD_RES       1      1       N-acetylalanine.
FT   MOD_RES      58     58       Methionine amide.
FT   MOD_RES      51     51       N6-methyllysine (Potential).
FT   MOD_RES     198    198       Phosphoserine; by CK2.
FT   MOD_RES     367    367       Sulfotyrosine (By similarity).

Example of a feature where the identity of the amino acid is unknown (an X is shown at this position in the sequence):

FT   MOD_RES       1      1       Blocked amino end (Xaa).

LIPID - Covalent binding of a lipid moiety

The chemical nature of the bound lipid moiety is given in the description. The general format of the LIPID description field is:

FT   LIPID       xxx    xxx       Name of the modified amino acid.

The attached groups that are currently defined are listed below.

Attached group Description
myristate Myristate group attached through an amide bond to the N-terminal glycine residue of the mature form of a protein [1,2] or to an internal lysine residue. The myristate can also be attached through a thioester bond to an internal cysteine
palmitate Palmitate group attached through an amide bond to the N-terminal cysteine of the mature form of a protein, or to an internal lysine. The palmitate can also be attached through a thioester bond to an internal cysteine or through an ester bond to a serine or threonine residue [1,2]
farnesyl Farnesyl group attached through a thioether bond to a cysteine residue [3,4]
geranyl-geranyl Geranyl-geranyl group attached through a thioether bond to a cysteine residue [3,4]
GPI-anchor Glycosyl-phosphatidylinositol (GPI) group linked to the alpha-carboxyl group of the C-terminal residue of the mature form of a protein [5,6]
diacylglyceride Glyceryl group bearing two ester-linked fatty acids attached through a thioether bond to the N-terminal cysteine of the mature form of a prokaryotic lipoprotein [7]
archaeol Archaeol (2,3-di-O-phytanyl-sn-glycerol) lipid group attached through an thioether bond to the N-terminal cysteine of the mature form of a archaeal lipoprotein [8]
n-octanoate n-octanoate group linked through an ester bond to a serine residue
cholesterol Cholesterol group attached through an ester bond to the C-terminal glycine of the mature form of a protein

References:

  1. Grand R.J.A.
    Biochem. J. 258:626-638(1989).
  2. McIlhinney R.A.J.
    Trends Biochem. Sci. 15:387-391(1990).
  3. Glomset J.A., Gelb M.H., Farnsworth C.C.
    Trends Biochem. Sci. 15:139-142(1990).
  4. Sinensky M., Lutz R.J.
    BioEssays 14:25-31(1992).
  5. Low M.G.
    FASEB J. 3:1600-1608(1989).
  6. Low M.G.
    Biochim. Biophys. Acta 988:427-454(1989).
  7. Hayashi S., Wu H.C.
    J. Bioenerg. Biomembr. 22:451-471(1990).
  8. Nishihara M., Utagawa M., Akutsu H., Koga Y.
    J. Biol. Chem. 267:12432-12435(1992).

Examples of LIPID key feature lines:

FT   LIPID         2      2       N-myristoyl glycine; by host.
FT   LIPID         5      5       S-palmitoyl cysteine.
FT   LIPID       231    231       GPI-anchor amidated serine.
FT   LIPID        21     21       S-diacylglycerol cysteine.

The nature of the posttranslationally formed amino acid is annotated by using a controlled vocabulary; the currently defined list of controlled vocabulary, as well as other information such as the target amino acid, the related keyword, the species where the modification is annotated and the location of the mature protein are available in ptmlist.txt document. Links to example proteins and to the RESID database are also provided to help gain a better insight into every modification.

CARBOHYD - Glycosylation site.

This key describes the occurrence of the attachment of a glycan (mono- or polysaccharide) to a residue of the protein:

  • The type of linkage (C-, N- or O-linked) to the protein is indicated.
  • If the nature of the reducing terminal sugar is known, its abbreviation is shown between parenthesis. If three dots '...' follow the abbreviation this indicates an extension of the carbohydrate chain. Conversely no dots means that a monosaccharide is linked.

Examples of CARBOHYD key feature lines:

FT   CARBOHYD     53     53       N-linked (GlcNAc...) (Potential).
FT   CARBOHYD     18     18       O-linked (GlcNAc).
FT   CARBOHYD    194    194       O-linked (Glc...) (By similarity).
FT   CARBOHYD     32     32       C-linked (Man); partial.
FT   CARBOHYD     50     50       O-linked (Ara...) (Probable).

DISULFID - Disulfide bond.

The 'FROM' and 'TO' endpoints designate the two residues which are linked by an intra-chain disulfide bond. If the 'FROM' and 'TO' endpoints are identical, the disulfide bond is an interchain one and the description field indicates the nature of the cross-link. Examples of DISULFID key feature lines:

FT   DISULFID     23     84       Probable.
FT   DISULFID     29     29       Interchain (with C-8 in small chain).

CROSSLNK - Posttranslationally formed amino acid bonds.

The 'FROM' and 'TO' endpoints designate the two residues, which are linked by an intrachain bond, and the description field indicates the nature of the cross-link. If the 'FROM' and 'TO' endpoints are identical, the amino acid bond is an interchain one. The name of the linked peptide is indicated in the description field. Examples of 'CROSSLNK' key feature lines:

FT   CROSSLNK   1010   1013       Isoglutamyl cysteine thioester (Cys-Gln).
FT   CROSSLNK     60     77       Beta-methyllanthionine (Cys-Thr).
FT   CROSSLNK     63     73       Lanthionine (Ser-Cys).
FT   CROSSLNK     64     70       Beta-methyllanthionine (Cys-Thr).
FT   CROSSLNK     65     78       Lysinoalanine (Ser-Lys).

The nature of the posttranslationally formed amino acid bond is annotated by using a controlled vocabulary; the currently defined list of controlled vocabulary, as well as other information such as the target amino acid, the related keyword, the species where the modification is annotated and the location of the mature protein are available in ptmlist.txt document. Links to example proteins and to the RESID database are also provided to help gain a better insight into every modification.

VAR_SEQ - Description of sequence variants produced by alternative splicing, alternative promoter usage, alternative initiation and ribosomal frameshifting.

Examples of VAR_SEQ key feature lines:

FT   VAR_SEQ     653    672       VATSNPGKCLSFTNSTFTFT -> ALVSHHCPVEAVRAVHP
FT                                TRL (in isoform 2).
FT                                /FTId=VSP_003786.
FT   VAR_SEQ     673    913       Missing (in isoform 2).
FT                                /FTId=VSP_003787.

VARIANT - Authors report that sequence variants exist.

Examples of VARIANT key feature lines:

FT   VARIANT     214    214       V -> I.
FT                                /FTId=VAR_009122.
FT   VARIANT     237    237       I -> L (in strain: B293, Z3524, Z3910,
FT                                Z3915 and Z3918).
FT   VARIANT      21     22       Missing (in 35% of the chains).
FT                                /FTId=VAR_006353.
FT   VARIANT     265    344       Missing (in allele D4.2).
FT                                /FTId=VAR_003465.
FT   VARIANT     156    156       I -> V (in RNA edited version).
FT                                /FTId=VAR_010166.

Explicit links are present in protein sequence entries of Hominidae to the Single Nucleotide Polymorphism database (dbSNP) (Nucleic Acids Res. 29:308-311(2001); PMID: 11125122). The dbSNP identifiers in human FT VARIANT lines are prefixed by "rs". NCBI/dbSNP has rs and ss numbers, but we only refer to SNPs with rs numbers. The format of such links is:

FT   VARIANT    from     to	  Description (in dbSNP:rsaccession_number).
FT                                /FTId=VAR_number.

Example of a feature with a link to dbSNP:

FT   VARIANT     246    246       S -> A (in dbSNP:rs2228541).
FT                                /FTId=VAR_024350.

MUTAGEN - Site which has been experimentally altered by mutagenesis.

Examples of MUTAGEN key feature lines:

FT   MUTAGEN     119    119       C->R,E,A: Loss of cADPr hydrolase and
FT                                ADP-ribosyl cyclase activity.
FT   MUTAGEN     169    177       Missing: Abolishes ATP-binding.

UNSURE - Uncertainties in the sequence

Used to describe region(s) of a sequence for which the authors are unsure about the sequence assignment.

FT   UNSURE       12     12       V or Y.

CONFLICT - Different sources report differing sequences.

Examples of CONFLICT key feature lines:

FT   CONFLICT    484    484       Missing (in Ref. 2).
FT   CONFLICT    802    802       K -> Q (in Ref. 4, 5 and 10).
FT   CONFLICT      6     10       GSDSE -> RIRLR (in Ref. 2).
FT   CONFLICT    405    405       V -> A (in Ref. 6; AAF71067).

NON_CONS - Non-consecutive residues.

Indicates that two residues in a sequence are not consecutive and that there are a number of unsequenced residues between them. Example of a NON_CONS key feature line:

FT   NON_CONS   1683   1684

NON_TER - The residue at an extremity of the sequence is not the terminal residue.

If applied to position 1, this means that the first position is not the N-terminus of the complete molecule. If applied to the last position, it means that this position is not the C-terminus of the complete molecule. There is no description field for this key. Examples of NON_TER key feature lines:

FT   NON_TER       1      1
FT   NON_TER      29     29

Secondary structure (HELIX, STRAND, TURN) - The feature table of sequence entries of proteins whose tertiary structure is known experimentally contains the secondary structure information corresponding to that protein. The secondary structure assignment is made according to DSSP (see Kabsch W., Sander C.; Biopolymers, 22:2577-2637(1983)) and the information is extracted from the coordinate data sets of the Protein Data Bank (PDB).

In the feature table only three types of secondary structure are specified: helices (key HELIX), beta-strands (key STRAND) and turns (key TURN). Residues not specified in one of these classes are in a 'loop' or 'random-coil' structure. Because the DSSP assignment has more than the three common secondary structure classes, we have converted the different DSSP assignments to HELIX, STRAND and TURN as shown in the table below.

DSSP code DSSP definition Swiss-Prot assignment
H  Alpha-helix  HELIX
G  3(10) helix  HELIX
I  Pi-helix  HELIX
E  Hydrogen-bonded beta-strand (extended strand)  STRAND
B  Residue in an isolated beta-bridge  STRAND
T  H-bonded turn (3-turn, 4-turn or 5-turn)  TURN
S  Bend (five-residue bend centered at residue i)  Not specified

One should be aware of the following facts:

  1. Segment length. For helices (alpha and 3-10), the residue just before and just after the helix as given by DSSP participates in the helical hydrogen-bonding pattern with a single H-bond. For practical purposes, one can extend the HELIX range by one residue on each side, e.g. HELIX 25-35 instead of HELIX 26-34. Also, the ends of secondary structure segments are less well defined for lower-resolution structures. A fluctuation of one residue is common.
  2. Missing segments. In low-resolution structures, badly formed helices or strands may be omitted in the DSSP definition.
  3. Special helices and strands. Helices of length three are 3-10 helices, those of length four and longer are either alpha-helices or 3-10 helices (pi helices are extremely rare). A strand of one residue corresponds to a residue in an isolated beta-bridge. Such bridges can be structurally important.
  4. Missing secondary structure. No secondary structure is currently given in the feature table in the following cases:
    • No sequence data in the PDB entry;
    • Structure for which only C-alpha coordinates are in PDB;
    • NMR structure with more than one coordinate data set;
    • Model (i.e. theoretical) structure.

Examples:

FT   HELIX         2     11
FT   HELIX        12     14
FT   HELIX        21     35
FT   TURN         36     36
FT   TURN         46     47
FT   HELIX        49     59
FT   TURN         60     63
FT   HELIX        66     84
3.17. The SQ lineTable of contents

The SQ (SeQuence header) line marks the beginning of the sequence data and gives a quick summary of its content.

The format of the SQ line is:

SQ   SEQUENCE XXXX AA; XXXXX MW; XXXXXXXXXXXXXXXX CRC64;

The line contains the length of the sequence in amino acids ('AA') followed by the molecular weight ('MW') rounded to the nearest mass unit (Dalton) and the sequence 64-bit CRC (Cyclic Redundancy Check) value ('CRC64').

The molecular weight (MW) indicated on the SQ line is not meant to be that of the mature processed and posttranslationally modified protein. The MW of the mature protein can be predicted by the program Compute pI/MW tool on the ExPASy server.

The algorithm to compute the CRC64 is described in the ISO 3309 standard. The generator polynomial is x64 + x4 + x3 + x + 1.
Reference: Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T. "Numerical recipes in C", 2nd ed., pp896-902, Cambridge University Press (1993). (See http://library.lanl.gov/numerical/bookcpdf.html)

It should be noted that while, in theory, two different sequences could have the same CRC64 value, the likelihood that this would happen is extremely low.

An example of an SQ line is shown here:

SQ   SEQUENCE   486 AA;  55639 MW;  D7862E867AD74383 CRC64;

The information in the SQ line can be used as a check on accuracy or for statistical purposes. The word 'SEQUENCE' is present solely for readability.

3.18. The sequence data lineTable of contents

The sequence data line has a line code consisting of two blanks rather than the two-letter codes used until now. The sequence counts 60 amino acids per line, in groups of 10 amino acids, beginning in position 6 of the line.

The characters used for the amino acids are the standard IUPAC one letter codes (see Amino-acid codes section).

An example of sequence data preceded by the corresponding SQ line is shown here:

SQ   SEQUENCE   97 AA;  9110 MW;  E3C20C259858B830 CRC64;
     MTILASICKL GNTKSTSSSI GSSYSSAVSF GSNSVSCGEC GGDGPSFPNA SPRTGVKAGV
     NVDGLLGAIG KTVNGMLISP NGGGGGMGMG GGSCGCI
3.19. The // lineTable of contents

The // (terminator) line contains no data or comments and designates the end of an entry.

Appendix A : Amino-acid codesTable of contents

The one-letter and three-letter codes for amino acids used in the knowledgebase are those adopted by the commission on Biochemical Nomenclature of the IUPAC-IUB (see the reference listed below).

One-letter code Three-letter code Amino-acid name
A Ala   Alanine
R Arg   Arginine
N Asn   Asparagine
D Asp   Aspartic acid
C Cys   Cysteine
Q Gln   Glutamine
E Glu   Glutamic acid
G Gly   Glycine
H His   Histidine
I Ile   Isoleucine
L Leu   Leucine
K Lys   Lysine
M Met   Methionine
F Phe   Phenylalanine
P Pro   Proline
S Ser   Serine
T Thr   Threonine
W Trp   Tryptophan
Y Tyr   Tyrosine
V Val   Valine
O Pyl   Pyrrolysine
U Sec   Selenocysteine
B Asx   Aspartic acid or Asparagine
Z Glx   Glutamic acid or Glutamine
X Xaa   Any amino acid

Reference

IUPAC-IUB Joint Commission on Biochemical Nomenclature (JCBN).
Nomenclature and Symbolism for Amino Acids and Peptides. Recommendations 1983.
Eur. J. Biochem. 138:9-37(1984).

See also: http://www.chem.qmw.ac.uk/iupac/AminoAcid/

Appendix B : Format differences between the Swiss-Prot and EMBL databasesTable of contents

B.1 Generalities

The format of Swiss-Prot follows as closely as possible that of the EMBL database. The general structure of an entry is identical in both databases. The status are the same except though Swiss-Prot does not make use of the data classes and uses the 'reviewed' status instead. One line type used in Swiss-Prot does not exist in the EMBL database (see this section); conversely Swiss-Prot does not currently make use of every EMBL line type (see this section).

B.2 Differences in line types present in both databases
B.2.1 The ID line (IDentification)

Differences with the EMBL database ID line format are:

  • The entry name can be up to 10 characters long (instead of 9 in EMBL) and can begin with a numerical character;
  • EMBL entry ID lines have an additional three-letter taxonomic division 'token' inserted between the status and the molecule type;
  • The molecule type is not listed;
  • The length of the molecule is followed by 'AA' (Amino Acid) instead of 'BP' (Base Pairs).
B.2.2 The AC line (ACcession number)

The format of this line type is identical to that defined by the EMBL database. Swiss-Prot and TrEMBL accession numbers do not overlap those used in the EMBL/GenBank/DDBJ nucleotide sequence database. However, it should be noted that there are differences in the format of the accession numbers themselves. In Swiss-Prot and TrEMBL accession numbers consist of 6 alphanumerical characters in the following format:

1 2 3 4 5 6
[A-N,R-Z] [0-9] [A-Z] [A-Z, 0-9] [A-Z, 0-9] [0-9]
[O,P,Q] [0-9] [A-Z, 0-9] [A-Z, 0-9] [A-Z, 0-9] [0-9]

Examples: P01234; Q1AA12.

In EMBL, two different types of accession numbers co-exist:

  1. Accession numbers with 6 alphanumerical characters, where the first character is any letter with the exception of O,P or Q and the five other characters are numbers (example: M23765);
  2. Accession numbers with 8 alphanumerical characters, where the first two characters are letters and the following six characters are numbers (example: AB001084).
B.2.3 The DT line (DaTe)

Differences with the EMBL database DT line format are:

  • In EMBL there are two DT lines per entry whereas there are three in Swiss-Prot;
  • In EMBL the format of the DT line that indicates when an entry was created is identical to that defined in Swiss-Prot; but the two DT lines that convey information relevant to the updating of an entry are replaced by a single line in EMBL. This is shown in the example below.

DT lines in a Swiss-Prot entry:

DT   01-OCT-1989, integrated into UniProtKB/Swiss-Prot.
DT   01-OCT-1989, sequence version 1.
DT   07-FEB-2006, entry version 76.

DT lines in an EMBL database entry:

DT   10-MAR-1990 (Rel. 22, Created)
DT   12-APR-1990 (Rel. 23, Last updated, Version 3)
B.2.4 The DE line (DEscription)
  • In the UniProt Knowledgebase the species of origin is not included in the description;
  • In EMBL the last DE line is not terminated by a period.
B.2.5 The OS line (Organism Species)
  • In EMBL the last OS line is not terminated by a period.
B.2.6 The OG line (OrGanelle)
  • EMBL makes a distinction between 'Mitochondrion', and 'Kinetoplast', while Swiss-Prot does not use the latter designation;
  • EMBL makes a distinction between 'Chloroplast' and 'Plastid', while Swiss-Prot does not use the latter designation;
  • In EMBL the OG line is not terminated by a period.
B.2.7 The RP and RC lines
  • In EMBL, unlike Swiss-Prot, the RC line precedes the RP line;
  • In EMBL the RC line is in free format and is generally not used.
B.2.8 The RT line (Reference Title)

In EMBL the reference title is not terminated by a period, a question mark or an exclamation mark.

B.2.9 The FT line (Feature Table)

The format of this line is totally different from that currently defined for the EMBL database. The format used in Swiss-Prot is similar to that which was used in older versions of the EMBL database, prior to the introduction of the common EMBL/GenBank/DDBJ feature table.

B.2.10 The CC line (Comment)

The comment lines, which are free text and can appear anywhere in an EMBL entry, are grouped together in the Swiss-Prot database. They are always listed below the last reference line, and follow a precise syntax (see section 3.22).

B.2.11 The SQ line (SeQuence header)

Although the rough format and purpose of this line type is conserved, its exact content differs from that of the EMBL database. The numerical length of the sequence is listed, followed by 'AA' (Amino Acid) instead of 'BP' (Base Pairs). Rather then indicating the sequence composition which, for protein sequences, would not fit in a single line, the molecular weight and the 64-bit CRC (Cyclic Redundancy Check) value of the sequence are indicated.

B.3 Line types defined by Swiss-Prot but currently not used by EMBL

Presently, there are two line types in Swiss-Prot, which are not used in the EMBL database: the GN and OX lines.

B.4 Line types defined by EMBL but currently not used by Swiss-Prot

There are three line types in the EMBL database, which are not used in Swiss-Prot:

  • FH and XX. The FH and XX lines contain no data and are present in EMBL only to improve readability of an entry when it is printed or displayed on a terminal screen. These lines are not included in Swiss-Prot so as to keep it as compact as possible and thereby facilitate its use on small computer systems.
  • SV. The SV (Sequence Version) line contains an identifier specific to nucleic acid sequences. It has no meaning in the context of Swiss-Prot.
Appendix C : Documentation filesTable of contents

The knowledgebase is distributed with a large number of documentation files. Some of these files have been available for a long time (the user manual, release notes, the various indexes for authors, citations, keywords, etc.), but many have been created recently and we are continuously adding new files, and updating and modifying existing files. The following table lists all the documents that are currently available.

userman.html User manual
relnotes.html UniProtKB/Swiss-Prot/TrEMBL release notes
sp_news.htm What's new ?
sp_soon.htm Forthcoming changes
shortdes.txt Short description of entries in Swiss-Prot
   
jourlist.txt List of cited journals
keywlist.txt List of keywords and definition of their usage
plasmid.txt List of plasmids
pathway.txt Index of CC PATHWAY lines
pathlist.txt List of pathways and definition of their usage
similar.txt Index of CC SIMILARITY lines
speclist.txt List of organisms identification codes
strains.txt List of strains
subcell.txt List of subcellular locations and definition of their usage
tisslist.txt List of tissues
experts.txt List of on-line experts for PROSITE and Swiss-Prot
dbxref.txt List of databases cross-referenced in Swiss-Prot
   
acindex.txt Accession number index
autindex.txt Authors index
citindex.txt Citation index
keyindex.txt Keywords index
speindex.txt Species index
delac_sp.txt List of accession numbers deleted from Swiss-Prot
delac_tr.txt List of accession numbers deleted from TrEMBL
   
7tmrlist.txt List of 7-transmembrane G-linked receptor entries
aatrnasy.txt List of aminoacyl-tRNA synthetases
allergen.txt Nomenclature and index of allergen sequences
annbioch.txt Swiss-Prot annotation: how is biochemical information assigned to sequence entries
arath.txt Index of Arabidopsis thaliana entries and their corresponding gene designations
bacsu.txt Index of Bacillus subtilis strain 168 chromosomal entries and their corresponding SubtiList cross-references
bloodgrp.txt Blood group antigen proteins
bucai.txt Index of Buchnera aphidicola (subsp. Acyrthosiphon pisum) entries
bucap.txt Index of Buchnera aphidicola (subsp. Schizaphis graminum) entries
calbican.txt Index of Candida albicans entries and their corresponding gene designations
rice.txt Index of Oryza sativa subsp. japonica (rice) entries and their corresponding gene designations
cdlist.txt CD nomenclature for surface proteins of human leucocytes
celegans.txt Index of Caenorhabditis elegans entries and their corresponding gene designations and WormPep cross-references
dicty.txt Index of Dictyostelium discoideum entries and their corresponding gene designations and dictyBase cross-references
ecoli.txt Index of Escherichia coli strain K12 chromosomal entries and their corresponding EcoGene cross-references
extradom.txt Nomenclature of extracellular domains
fly.txt Index of Drosophila entries and their corresponding FlyBase cross-references
glycosid.txt Classification of glycosyl hydrolase families and index of glycosyl hydrolase entries in Swiss-Prot
haein.txt Index of Haemophilus influenzae strain Rd chromosomal entries
helpy.txt Index of Helicobacter pylori strain 26695 chromosomal entries
hoxlist.txt Vertebrate homeotic Hox proteins: nomenclature and index
humchr01.txt Index of proteins encoded on human chromosome 1
humchr02.txt Index of proteins encoded on human chromosome 2
humchr03.txt Index of proteins encoded on human chromosome 3
humchr04.txt Index of proteins encoded on human chromosome 4
humchr05.txt Index of proteins encoded on human chromosome 5
humchr06.txt Index of proteins encoded on human chromosome 6
humchr07.txt Index of proteins encoded on human chromosome 7
humchr08.txt Index of proteins encoded on human chromosome 8
humchr09.txt Index of proteins encoded on human chromosome 9
humchr10.txt Index of proteins encoded on human chromosome 10
humchr11.txt Index of proteins encoded on human chromosome 11
humchr12.txt Index of proteins encoded on human chromosome 12
humchr13.txt Index of proteins encoded on human chromosome 13
humchr14.txt Index of proteins encoded on human chromosome 14
humchr15.txt Index of proteins encoded on human chromosome 15
humchr16.txt Index of proteins encoded on human chromosome 16
humchr17.txt Index of proteins encoded on human chromosome 17
humchr18.txt Index of proteins encoded on human chromosome 18
humchr19.txt Index of proteins encoded on human chromosome 19
humchr20.txt Index of proteins encoded on human chromosome 20
humchr21.txt Index of proteins encoded on human chromosome 21
humchr22.txt Index of proteins encoded on human chromosome 22
humchrx.txt Index of proteins encoded on human chromosome X
humchry.txt Index of proteins encoded on human chromosome Y
humpvar.txt Index of human proteins with sequence variants
humsavar.txt Index of sequence variation in human proteins
initfact.txt List and index of translation initiation factors
intein.txt Index of intein-containing entries referenced in Swiss-Prot
metallo.txt Classification of metallothioneins and index of the entries in Swiss-Prot
metja.txt Index of Methanococcus jannaschii entries
mgdtosp.txt Index of MGD entries referenced in Swiss-Prot
mimtosp.txt Index of MIM entries referenced in Swiss-Prot
mycge.txt Index of Mycoplasma genitalium strain G-37 entries
mycpn.txt Index of Mycoplasma pneumoniae strain M129 entries
nameprot.txt Protein naming guidelines
ngr234.txt Table of predicted proteins in Rhizobium plasmid pNGR234a
nomlist.txt List of nomenclature related references for proteins
pdbtosp.txt Index of Protein Data Bank (PDB) entries referenced in Swiss-Prot
pe_criteria.txt List of criteria used to assign a PE level to entries
peptidas.txt Classification of peptidase families and index of peptidase entries in Swiss-Prot
pkinfam.txt classification of human and mouse protein kinases
plastid.txt List of plastid encoded proteins
pombe.txt Index of Schizosaccharomyces pombe entries and their corresponding gene designations
protspot.txt Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries
ptmlist.txt List of post-translational modifications
restric.txt List of restriction enzyme and methylase entries
ribosomp.txt Index of ribosomal proteins classified by families on the basis of sequence similarities
ricpr.txt Index of Rickettsia prowazekii strain Madrid E entries
scorpktx.txt List of potassium-channel-specific scorpion toxins known to date
syny3.txt Index of Synechocystis sp. strain PCC 6803 entries
upflist.txt UPF (Uncharacterized Protein Families) list and index of members
yeast.txt Index of Saccharomyces cerevisiae entries in Swiss-Prot and their corresponding gene designations
yeast1.txt Yeast chromosome I entries
yeast2.txt Yeast chromosome II entries
yeast3.txt Yeast chromosome III entries
yeast5.txt Yeast chromosome V entries
yeast6.txt Yeast chromosome VI entries
yeast7.txt Yeast chromosome VII entries
yeast8.txt Yeast chromosome VIII entries
yeast9.txt Yeast chromosome IX entries
yeast10.txt Yeast chromosome X entries
yeast11.txt Yeast chromosome XI entries
yeast13.txt Yeast chromosome XIII entries
yeast14.txt Yeast chromosome XIV entries
Appendix D : FTP access to Swiss-Prot and TrEMBLTable of contents

D.1 Generalities

Swiss-Prot and TrEMBL, i.e. the UniProt Knowledgebase, is available for download on the following anonymous FTP servers:

Organization Swiss Institute of Bioinformatics (SIB)
Address ftp.expasy.org, au.expasy.org, bo.expasy.org, ca.expasy.org, cn.expasy.org, kr.expasy.org, tw.expasy.org, us.expasy.org
Directory /databases/uniprot/current_release/knowledgebase/
   
Organization European Bioinformatics Institute (EBI)
Address ftp.ebi.ac.uk
Directory /pub/databases/uniprot/current_release/knowledgebase/
   
Organization Protein Information Resource (PIR)
Address ftp.uniprot.org
Directory /pub/databases/uniprot/current_release/knowledgebase/
D.2 UniProt Knowledgebase

The UniProt Knowledgebase is a non-redundant and complete protein sequence database consisting of two components:

  1. Swiss-Prot
  2. TrEMBL

Every two weeks two files are completely rebuilt. These files are named: uniprot_sprot.dat.gz and uniprot_trembl.dat.gz. As indicated by their '.gz' extension, these are gzip-compressed files which, when decompressed, produce ASCII files in Swiss-Prot format.

The same data is available in fasta and xml format. The fasta files are useful for building the databases used by FASTA, BLAST and other sequence similarity search programs. Please do not use these files for any other purpose, as you will lose all annotations by using this stripped-down format.

Additional notes:

  • The Swiss-Prot file continuously grows as new annotated sequences are added.
  • The TrEMBL file slightly decreases in size as sequences are moved out of TrEMBL after being annotated and moved into Swiss-Prot. However, at the same time, TrEMBL increases on a much larger scale by the new coding sequences submitted to the nucleotide sequence databases.
  • Swiss-Prot and TrEMBL share the same system of accession numbers. Therefore you will not find any primary accession number duplicated between the two sections. A TrEMBL entry (and its associated accession number(s)) can either move to Swiss-Prot as a new entry or be merged with an existing Swiss-Prot entry. In the latter case, the accession number(s) of that TrEMBL entry are added to that of the Swiss-Prot entry.
  • While these two files allow you to build what we call a 'non-redundant' database, the UniProt Knowledgebase, it must be noted that this is not completely a true statement. Without going into a long explanation we can say that this is currently the best attempt in providing a complete selection of protein sequence entries while trying to eliminate redundancies (2 or more entries for the same gene of a species). While Swiss-Prot is non-redundant, TrEMBL is far from being non-redundant and the addition of Swiss-Prot + TrEMBL is even less so.
  • To describe to your users the version of the UniProt Knowledgebase that you are providing them with, you should use a statement of the form:

    UniProtKB release 2.0 consists of:
    • Swiss-Prot release 44.x of xx-yyy-2004;
    • TrEMBL release 27.x of xx-yyy-2004;
D.3 Biweekly updates of UniProtKB documents

All Swiss-Prot documents are updated with every biweekly release of UniProtKB, along with other documents related to the UniProt Knowledgebase. They are available for FTP download from the directory /databases/uniprot/current_release/knowledgebase/complete/docs/.

D.4 Biweekly (cumulative) updates of Swiss-Prot

Biweekly updates of Swiss-Prot are available by anonymous FTP, from /databases/swiss-prot/updates_compressed/. Three files are generated at each update, and can be combined with the last full release (/databases/swiss-prot/release_compressed/):

new_seq.dat Contains all the new entries since the last full release;
upd_seq.dat Contains the entries for which the sequence data has been updated since the last release;
upd_ann.dat Contains the entries for which one or more annotation fields have been updated since the last release.

Important notes

  • Instead of using the above files, you can, every two weeks, download an updated copy of the Swiss-Prot database. This file is available in the UniProt directory (see this section).
Appendix E : Relationships between Swiss-Prot and some biomolecular databasesTable of contents

The current status of the relationships (cross-references) between Swiss-Prot and some biomolecular databases is shown in the following schema:

Cross-References

----- end of document

ExPASy logo ExPASy Home page Site Map Search ExPASy Contact us Swiss-Prot
 Hosted by au flag APAF Australia Mirror sites: Brazil  Canada  China  Korea  Switzerland
Notice: This page will be replaced with www.uniprot.org. Please send us your feedback!